Overview

  • Product name

    Anti-LIF antibody (Biotin)
    See all LIF primary antibodies
  • Description

    Rabbit polyclonal to LIF (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: Sandwich ELISA, WBmore details
  • Species reactivity


    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LIF aa 23-202. Produced in E. coli. Full length mature chain without signal peptide.
    Sequence:

    SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGE PFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRD QKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDT SGKDVFQKKKLGCQLLGKYKQIIAVLAQAF


    Database link: P15018

  • Positive control

    • WB: Recombinant human LIF protein. sELISA: Recombinant human LIF protein.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab245854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 22 kDa.

No endogenous data, tested with recombinant protein only.

Target

  • Function

    LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
  • Sequence similarities

    Belongs to the LIF/OSM family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDF antibody
    • Cholinergic Differentiation Factor antibody
    • D factor antibody
    • DIA antibody
    • Differentiation inducing factor antibody
    • differentiation inhibitory activity antibody
    • Differentiation stimulating factor antibody
    • Differentiation-stimulating factor antibody
    • Emfilermin antibody
    • Hepatocyte stimulating factor III antibody
    • HILDA antibody
    • Human interleukin in DA cells antibody
    • Leukemia inhibitory factor antibody
    • LIF antibody
    • LIF_HUMAN antibody
    • Melanoma derived LPL inhibitor antibody
    • Melanoma-derived LPL inhibitor antibody
    • MLPLI antibody
    see all

Images

  • To detect human LIF by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 μg/ml.

    When used in conjunction with compatible development reagents the detection limit for recombinant human LIF is 1.5 – 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lanes 1-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng/lane respectively.

  • To detect human LIF by sandwich ELISA (using 100 μl/well) a concentration of 0.25 – 1.0 μg/ml of this antibody is required. This biotinylated polyclonal antibody, in conjunction with a capture antibody,allows the detection of at least 0.2 – 0.4 ng/well of recombinant human LIF.

References

ab245854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up