Overview

  • Product name

  • Description

    Rabbit polyclonal to LIFR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Rat LIFR aa 500-550 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    IYTFRVRCSSETFWKWSKWSNEKRYLTTEATPSKGPDTWREWSSDGKNLI I


    Database link: O70535

  • Positive control

    • Human colon carcinoma and Human breast carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab202847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/100.
IHC-P 1/100 - 1/500.
WB 1/100 - 1/1000. Predicted molecular weight: 122 kDa.

Target

  • Function

    Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.
  • Involvement in disease

    Defects in LIFR are the cause of Stueve-Wiedemann syndrome (SWS) [MIM:601559]; also knowns as Schwartz-Jampel syndrome type 2 (SJS2). SWS is a severe autosomal recessive condition and belongs to the group of the bent-bone dysplasias. SWS is characterized by bowing of the lower limbs, with internal cortical thickening, wide metaphyses with abnormal trabecular pattern, and camptodactyly. Additional features include feeding and swallowing difficulties, as well as respiratory distress and hyperthermic episodes, which cause death in the first months of life. The rare survivors develop progressive scoliosis, spontaneous fractures, bowing of the lower limbs, with prominent joints and dysautonomia symptoms, including temperature instability, absent corneal and patellar reflexes, and smooth tongue.
    Note=A chromosomal aberration involving LIFR is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(5;8)(p13;q12) with PLAG1.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 6 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD118 antibody
    • CD118 antigen antibody
    • FLJ98106 antibody
    • FLJ99923 antibody
    • Leukemia inhibitory factor receptor alpha antibody
    • Leukemia inhibitory factor receptor antibody
    • LIF R antibody
    • LIF receptor antibody
    • LIF-R antibody
    • Lifr antibody
    • LIFR_HUMAN antibody
    • SJS2 antibody
    • STWS antibody
    • SWS antibody
    see all

Images

  • Flow Cytometry of Human U937 cells with ab216508 at 1/100
  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human breast carcinomal tissue labeling LIFR with ab202847 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon carcinomal tissue labeling LIFR with ab202847 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Huo L  et al. Leukemia Inhibitory Factor Receptor Is Involved in Apoptosis in Rat Astrocytes Exposed to Oxygen-Glucose Deprivation. Biomed Res Int 2019:1613820 (2019). Read more (PubMed: 30937308) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up