Overview

  • Product name
  • Description
    Rabbit polyclonal to LIFR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human, Pig
    Predicted to work with: Dog
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human LIFR aa 692-833. (Expressed in E.coli).
    Sequence:

    RPGIRYNFFLYGCRNQGYQLLRSMIGYIEELAPIVAPNFTVEDTSADSIL VKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGRSDIKVKNITDI SQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENS


    Database link: P42702

  • Positive control
    • IHC-P: Human kidney tissue. WB: Recombinant human LIFR protein; Pig skeletal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function
    Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.
  • Involvement in disease
    Defects in LIFR are the cause of Stueve-Wiedemann syndrome (SWS) [MIM:601559]; also knowns as Schwartz-Jampel syndrome type 2 (SJS2). SWS is a severe autosomal recessive condition and belongs to the group of the bent-bone dysplasias. SWS is characterized by bowing of the lower limbs, with internal cortical thickening, wide metaphyses with abnormal trabecular pattern, and camptodactyly. Additional features include feeding and swallowing difficulties, as well as respiratory distress and hyperthermic episodes, which cause death in the first months of life. The rare survivors develop progressive scoliosis, spontaneous fractures, bowing of the lower limbs, with prominent joints and dysautonomia symptoms, including temperature instability, absent corneal and patellar reflexes, and smooth tongue.
    Note=A chromosomal aberration involving LIFR is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(5;8)(p13;q12) with PLAG1.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 6 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD118 antibody
    • CD118 antigen antibody
    • FLJ98106 antibody
    • FLJ99923 antibody
    • Leukemia inhibitory factor receptor alpha antibody
    • Leukemia inhibitory factor receptor antibody
    • LIF R antibody
    • LIF receptor antibody
    • LIF-R antibody
    • Lifr antibody
    • LIFR_HUMAN antibody
    • SJS2 antibody
    • STWS antibody
    • SWS antibody
    see all

Images

  • Anti-LIFR antibody (ab232877) at 1 µg/ml + Pig skeletal muscle lysate.
  • Anti-LIFR antibody (ab232877) at 1 µg/ml + Recombinant human LIFR protein.
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for LIFR using ab232877 at 30 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up