Overview

  • Product name

  • Description

    Rabbit polyclonal to LIFR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LIFR aa 915-1086.
    Sequence:

    SAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNPAAD EAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVE DIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSIN SRQFLIPPKDEDSPKSNGGGWS


    Database link: P42702

  • Positive control

    • WB: Rat brain lysate; HeLa, U-87 MG and K562 whole cell lysates. IHC-P: Human lung and lung cancer tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 124 kDa.
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.
  • Involvement in disease

    Defects in LIFR are the cause of Stueve-Wiedemann syndrome (SWS) [MIM:601559]; also knowns as Schwartz-Jampel syndrome type 2 (SJS2). SWS is a severe autosomal recessive condition and belongs to the group of the bent-bone dysplasias. SWS is characterized by bowing of the lower limbs, with internal cortical thickening, wide metaphyses with abnormal trabecular pattern, and camptodactyly. Additional features include feeding and swallowing difficulties, as well as respiratory distress and hyperthermic episodes, which cause death in the first months of life. The rare survivors develop progressive scoliosis, spontaneous fractures, bowing of the lower limbs, with prominent joints and dysautonomia symptoms, including temperature instability, absent corneal and patellar reflexes, and smooth tongue.
    Note=A chromosomal aberration involving LIFR is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(5;8)(p13;q12) with PLAG1.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 6 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD118 antibody
    • CD118 antigen antibody
    • FLJ98106 antibody
    • FLJ99923 antibody
    • Leukemia inhibitory factor receptor alpha antibody
    • Leukemia inhibitory factor receptor antibody
    • LIF R antibody
    • LIF receptor antibody
    • LIF-R antibody
    • Lifr antibody
    • LIFR_HUMAN antibody
    • SJS2 antibody
    • STWS antibody
    • SWS antibody
    see all

Images

  • All lanes : Anti-LIFR antibody (ab235908) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 4 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 124 kDa

     

  • Paraffin-embedded human lung cancer tissue stained for LIFR using ab235908 at 1/600 dilution in immunohistochemical analysis. 

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human lung tissue stained for LIFR using ab235908 at 1/600 dilution in immunohistochemical analysis. 

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • 4% formaldehyde fixed, 0.2% Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for LIFR (green) using ab235908 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab235908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up