Overview

  • Product name

    Anti-LIGHT/TNFSF14 antibody
    See all LIGHT/TNFSF14 primary antibodies
  • Description

    Rabbit polyclonal to LIGHT/TNFSF14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity


    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse LIGHT/TNFSF14 aa 58-239. (E.coli derived).
    Sequence:

    MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGI GGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGL ANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVV HLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV


    Database link: Q9QYH9

  • Positive control

    • WB: Recombinant mouse LIGHT/TNFSF14 protein.
  • General notes

     This product was previously labelled as LIGHT

     

Properties

  • Form

    Lyophilised:For lot specific reconstitution information please contact our Scientific Support Team.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Constituent: PBS

    Sterile filtered
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233502 was purified by affinity chromatography employing an immobilized Murine LIGHT/TNFSF14 matrix.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 26 kDa.
Sandwich ELISA Use a concentration of 0.5 - 2 µg/ml. Can be paired for Sandwich ELISA with Rabbit polyclonal to LIGHT/TNFSF14 (Biotin) (ab233504).

Target

  • Function

    Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. Acts as a receptor for Herpes simplex virus.
  • Tissue specificity

    Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    N-glycosylated.
    The soluble form of isoform 1 derives from the membrane form by proteolytic processing.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 258 antibody
    • CD258 antibody
    • CD258 antigen antibody
    • Delta transmembrane LIGHT antibody
    • Herpes virus entry mediator ligand antibody
    • Herpesvirus entry mediator A antibody
    • Herpesvirus entry mediator ligand antibody
    • herpesvirus entry mediator-ligand antibody
    • HVEM L antibody
    • HVEM-L antibody
    • HVEML antibody
    • Ligand for herpesvirus entry mediator antibody
    • LIGHT antibody
    • LTg antibody
    • soluble form antibody
    • TNF14 antibody
    • TNF14_HUMAN antibody
    • TNFSF 14 antibody
    • Tnfsf14 antibody
    • TNFSF14 protein antibody
    • TR 2 antibody
    • TR2 antibody
    • Tumor necrosis factor (ligand) superfamily, member 14 antibody
    • Tumor necrosis factor ligand superfamily member 14 antibody
    • Tumor necrosis factor ligand superfamily, member 14 antibody
    • Tumor necrosis factor receptor like 2 antibody
    • tumor necrosis factor receptor-like 2 antibody
    • Tumor necrosis factor superfamily member 14 antibody
    • Tumor necrosis factor superfamily member LIGHT antibody
    see all

Images

  • All lanes : Anti-LIGHT/TNFSF14 antibody (ab233502) at 0.2 µg/ml

    Lane 1 : Recombinant mouse LIGHT/TNFSF14 protein, 250 ng
    Lane 2 : Recombinant mouse LIGHT/TNFSF14 protein, 125 ng
    Lane 3 : Recombinant mouse LIGHT/TNFSF14 protein, 62.5 ng
    Lane 4 : Recombinant mouse LIGHT/TNFSF14 protein, 31.25 ng
    Lane 5 : Recombinant mouse LIGHT/TNFSF14 protein, 15.625 ng
    Lane 6 : Recombinant mouse LIGHT/TNFSF14 protein, 7.8 ng
    Lane 7 : Recombinant mouse LIGHT/TNFSF14 protein, 3.9 ng
    Lane 8 : Recombinant mouse LIGHT/TNFSF14 protein, 1.95 ng
    Lane 9 : Recombinant mouse LIGHT/TNFSF14 protein, 0.975 ng
    Lane 10 : Recombinant mouse LIGHT/TNFSF14 protein, 0.49 ng
    Lane 11 : Recombinant mouse LIGHT/TNFSF14 protein, 0.24 ng

    Predicted band size: 26 kDa



    Reducing conditions.

  • All lanes : Anti-LIGHT/TNFSF14 antibody (ab233502) at 0.1 µg/ml

    Lane 1 : Recombinant mouse LIGHT/TNFSF14 protein, 250 ng
    Lane 2 : Recombinant mouse LIGHT/TNFSF14 protein, 125 ng
    Lane 3 : Recombinant mouse LIGHT/TNFSF14 protein, 62.5 ng
    Lane 4 : Recombinant mouse LIGHT/TNFSF14 protein, 31.25 ng
    Lane 5 : Recombinant mouse LIGHT/TNFSF14 protein, 15.625 ng
    Lane 6 : Recombinant mouse LIGHT/TNFSF14 protein, 7.8 ng
    Lane 7 : Recombinant mouse LIGHT/TNFSF14 protein, 3.9 ng
    Lane 8 : Recombinant mouse LIGHT/TNFSF14 protein, 1.95 ng
    Lane 9 : Recombinant mouse LIGHT/TNFSF14 protein, 0.98 ng
    Lane 10 : Recombinant mouse LIGHT/TNFSF14 protein, 0.49 ng
    Lane 11 : Recombinant mouse LIGHT/TNFSF14 protein, 0.24 ng

    Predicted band size: 26 kDa



    Non-reducing conditions..

  • ab233502, in conjunction a Biotinylated Anti-Murine LIGHT/TNFSF14 as a detection antibody, allows the detection of at least 2000-4000 pg/ml of Recombinant Murine LIGHT/TNFSF14.

References

ab233502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up