Overview

  • Product name

  • Description

    Rabbit polyclonal to LILRA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LILRA3 aa 222-313.
    Sequence:

    VSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGR QPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDP


    Database link: Q8N6C8

  • Positive control

    • WB: A549 and Jurkat whole cell lysates. IHC-P: Human lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 47 kDa.

Target

  • Function

    May act as soluble receptor for class I MHC antigens.
  • Tissue specificity

    Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung.
  • Sequence similarities

    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 85E antibody
    • CD85 antigen-like family member E antibody
    • CD85e antibody
    • CD85e antigen antibody
    • e3 antibody
    • HM 31 antibody
    • HM 43 antibody
    • HM31 antibody
    • HM43 antibody
    • ILT 6 antibody
    • ILT-6 antibody
    • ILT6 antibody
    • Immunoglobulin like transcript 6 antibody
    • Immunoglobulin-like transcript 6 antibody
    • Leucocyte immunoglobulin like receptor antibody
    • Leukocyte immunoglobulin like receptor 4 antibody
    • Leukocyte immunoglobulin like receptor A3 antibody
    • Leukocyte immunoglobulin like receptor subfamily A (without TM domain) member 3 antibody
    • Leukocyte immunoglobulin like receptor subfamily A member 3 antibody
    • Leukocyte immunoglobulin-like receptor 4 antibody
    • Leukocyte immunoglobulin-like receptor subfamily A member 3 antibody
    • LILRA 3 antibody
    • LILRA3 antibody
    • LIR 4 antibody
    • LIR-4 antibody
    • LIR4 antibody
    • LIRA3_HUMAN antibody
    • Monocyte inhibitory receptor HM43/HM31 antibody
    see all

Images

  • Paraffin-embedded human lung tissue stained for LILRA3 using ab235108 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • All lanes : Anti-LILRA3 antibody (ab235108) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa

References

ab235108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up