Overview

  • Product name

    Anti-LIM domain only 3 antibody
  • Description

    Rabbit polyclonal to LIM domain only 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, African green monkey
    Predicted to work with: Mouse, Rat, Cow, Zebrafish, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human LIM domain only 3 aa 96-145.
    Sequence:

    NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR


    Database link: Q8TAP4

  • Positive control

    • WB: COS-7 cell extracts. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000.
IHC-P Use at an assay dependent dilution.

Target

Images

  • All lanes : Anti-LIM domain only 3 antibody (ab230490) at 1/500 dilution

    Lane 1 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
    Lane 2 : COS-7 cell extract with Immunizing peptide

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human testis tissue stained for LIM domain only 3 with ab230490 at 1/100 dilution in immunohistochemical analysis.

References

ab230490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up