Overview

  • Product name

    Anti-LIM Kinase 1 antibody
    See all LIM Kinase 1 primary antibodies
  • Description

    Rabbit polyclonal to LIM Kinase 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human LIM Kinase 1 aa 465-512 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGN


    Database link: P53667

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes.
  • Tissue specificity

    Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.
  • Involvement in disease

    Note=LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 2 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
    Phosphorylated on serine and/or threonine residues by ROCK1. May be dephosphorylated and inactivated by SSH1.
    Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF6 leads to proteasomal degradation through the 26S proteasome, modulating LIMK1 levels in the growth cone and its effect on axonal outgrowth. Also polyubiquitinated by RLIM.
  • Cellular localization

    Cytoplasm. Cell projection > growth cone.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.1.37 antibody
    • LIM domain containing protein kinase antibody
    • LIM domain kinase 1 antibody
    • LIM kinase antibody
    • LIM motif containing protein kinase antibody
    • LIMK 1 antibody
    • LIMK antibody
    • LIMK-1 antibody
    • limk1 antibody
    • LIMK1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling LIM Kinase 1 using ab217690 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up