Anti-LINGO2 antibody - C-terminal (ab174806)

Overview

  • Product name
    Anti-LINGO2 antibody - C-terminal
    See all LINGO2 primary antibodies
  • Description
    Rabbit polyclonal to LINGO2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse LINGO2 aa 539-588 (C terminal). The exact sequence is proprietary. (NP_780725)
    Sequence:

    KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG


    Database link: Q3URE9

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab174806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

Images

  • Anti-LINGO2 antibody - C-terminal (ab174806) at 1 µg/ml + Mouse heart lysate at 10 µg

    Secondary
    Goat anti-Rabbit IgG-HRP

    Developed using the ECL technique.

    Predicted band size: 68 kDa

References

ab174806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up