Overview

  • Product name

  • Description

    Rabbit polyclonal to Lipin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse Lipin 1 aa 240-290 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PSSLVDCQRTPPHLAEGVLSSSCPLQSCHFHASESPSGSRPSTPKSDSEL V


    Database link: Q91ZP3

  • Positive control

    • Rat and mouse colon tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression (By similarity). Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol.
  • Tissue specificity

    Abundant in adipose tissue and skeletal muscle. Lower levels in some portions of the digestive tract.
  • Involvement in disease

    Defects in LPIN1 are a cause of autosomal recessive acute recurrent myoglobinuria (ARARM) [MIM:268200]; also known as acute recurrent rhabdomyolysis. Recurrent myoglobinuria is characterized by recurrent attacks of rhabdomyolysis (necrosis or disintegration of skeletal muscle) associated with muscle pain and weakness and followed by excretion of myoglobin in the urine. Renal failure may occasionally occur. Onset is usually in early childhood under the age of 5 years.
  • Sequence similarities

    Belongs to the lipin family.
  • Domain

    Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL), a transcriptional binding motif, which mediates interaction with PPARA.
    Contains 1 Asp-Xaa-Asp-Xaa-Thr (DXDXT) motif, a catalytic motif essential for phosphatidate phosphatase activity.
  • Post-translational
    modifications

    Phosphorylated at multiple sites in response to insulin. Phosphorylation is controlled by the mTOR signaling pathway (By similarity). Dephosphorylated in response to epinephrine and oleic acid.
    Sumoylated.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC=3.1.3.4 antibody
    • KIAA0188 antibody
    • Lipin-1 antibody
    • Lpin1 antibody
    • LPIN1_HUMAN antibody
    • PAP1 antibody
    • Phosphatidate phosphatase LPIN1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat colon tissue labeling Lipin 1 with ab216496 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse colon tissue labeling Lipin 1 with ab216496 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up