Overview

  • Product name
  • Description
    Rabbit polyclonal to Lipin 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide aa 250-300 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PPHLAEGVLSSSCPLQSCHFHASESPSGSRPSTPKSDSELVSKSADRLTP K


    Database link: Q91ZP3

  • Positive control
    • Rat kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function
    Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression (By similarity). Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol.
  • Tissue specificity
    Abundant in adipose tissue and skeletal muscle. Lower levels in some portions of the digestive tract.
  • Involvement in disease
    Defects in LPIN1 are a cause of autosomal recessive acute recurrent myoglobinuria (ARARM) [MIM:268200]; also known as acute recurrent rhabdomyolysis. Recurrent myoglobinuria is characterized by recurrent attacks of rhabdomyolysis (necrosis or disintegration of skeletal muscle) associated with muscle pain and weakness and followed by excretion of myoglobin in the urine. Renal failure may occasionally occur. Onset is usually in early childhood under the age of 5 years.
  • Sequence similarities
    Belongs to the lipin family.
  • Domain
    Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL), a transcriptional binding motif, which mediates interaction with PPARA.
    Contains 1 Asp-Xaa-Asp-Xaa-Thr (DXDXT) motif, a catalytic motif essential for phosphatidate phosphatase activity.
  • Post-translational
    modifications
    Phosphorylated at multiple sites in response to insulin. Phosphorylation is controlled by the mTOR signaling pathway (By similarity). Dephosphorylated in response to epinephrine and oleic acid.
    Sumoylated.
  • Cellular localization
    Nucleus. Cytoplasm > cytosol. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC=3.1.3.4 antibody
    • KIAA0188 antibody
    • Lipin-1 antibody
    • Lpin1 antibody
    • LPIN1_HUMAN antibody
    • PAP1 antibody
    • Phosphatidate phosphatase LPIN1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat kidney tissue labeling Lipin 1 with ab216511 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up