Overview

  • Product name

  • Description

    Rabbit polyclonal to LITAF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Tbx1 aa 19-151.
    Sequence:

    APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPI PNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLS CGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC


    Database link: Q99732

  • Positive control

    • IHC-P: Human prostate tissue. WB: RT4 cell lysate. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as LITAF

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 17 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.
  • Tissue specificity

    Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
  • Involvement in disease

    Defects in LITAF are the cause of Charcot-Marie-Tooth disease type 1C (CMT1C) [MIM:601098]. CMT1C is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet.
    Note=Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis. EMPD is a cancerous disease representing about 8% of all malignant skin cancers; it usually appears in the anogenital area and can be fatal by metastasizing to internal organs when left untreated for a long time. The clinical features are usually those of eczematous eruptions with weeping and crust formation.
  • Domain

    The WW-binding motif mediates interaction with WWOX and, probably NEDD4.
  • Cellular localization

    Lysosome membrane. Associated with membranes of lysosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Lipopolysaccharide induced TNF alpha factor antibody
    • CMT1C antibody
    • FLJ38636 antibody
    • Lipopolysaccharide induced TNF alpha factor antibody
    • Lipopolysaccharide induced TNF factor antibody
    • Lipopolysaccharide induced tumor necrosis factor alpha factor antibody
    • Lipopolysaccharide-induced tumor necrosis factor-alpha factor antibody
    • LITAF antibody
    • LITAF_HUMAN antibody
    • LPS induced TNF alpha factor antibody
    • LPS-induced TNF-alpha factor antibody
    • MGC116698 antibody
    • MGC116700 antibody
    • MGC116701 antibody
    • MGC125274 antibody
    • MGC125275 antibody
    • MGC125276 antibody
    • p53 induced gene 7 protein antibody
    • p53-induced gene 7 protein antibody
    • PIG 7 antibody
    • PIG7 antibody
    • SIMPLE antibody
    • Small integral membrane protein of lysosome/late endosome antibody
    • TP53I7 antibody
    • Tumor protein p53 inducible protein 7 antibody
    see all

Images

  • Paraffin embedded human prostate tissue stained for Tbx1 with ab224066 (1/20 dilution) in immunohistochemical analysis.

  • Anti-LITAF antibody (ab224066) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 17 kDa

  • A431 (human epidermoid carcinoma cell line) cells stained for Tbx1 (green) using ab224066 (4 µg/ml) in ICC/IF.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up