Overview

  • Product name

    Anti-Liver Arginase antibody [ARG1/1126]
    See all Liver Arginase primary antibodies
  • Description

    Mouse monoclonal [ARG1/1126] to Liver Arginase
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human Liver Arginase aa 1-150. The exact sequence is proprietary.
    Sequence:

    MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDY GDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK


    Database link: P05089

  • Positive control

    • Human hepatocellular tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    ab215894 is purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    ARG1/1126
  • Isotype

    IgG3
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 2 - 4 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Pathway

    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Involvement in disease

    Defects in ARG1 are the cause of argininemia (ARGIN) [MIM:207800]; also known as hyperargininemia. Argininemia is a rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia, progressive spastic quadriplegia.
  • Sequence similarities

    Belongs to the arginase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • A I antibody
    • Al antibody
    • ARG 1 antibody
    • arg1 antibody
    • ARGI1_HUMAN antibody
    • Arginase 1 antibody
    • Arginase liver antibody
    • Arginase type I antibody
    • Arginase, liver antibody
    • Arginase-1 antibody
    • Arginase1 antibody
    • Liver type arginase antibody
    • Liver-type arginase antibody
    • Type I arginase antibody
    see all

Images

  • ab215894 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human hepatocellular carcinoma tissue labeling Liver Arginase with ab215894 at 4µg/ml.

References

ab215894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up