Overview

  • Product name

    Anti-Liver Arginase antibody [MM0662-41P23]
    See all Liver Arginase primary antibodies
  • Description

    Mouse monoclonal [MM0662-41P23] to Liver Arginase
  • Host species

    Mouse
  • Tested applications

    Suitable for: IP, Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Liver Arginase aa 1-321.
    Sequence:

    MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDY GDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK ELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM TEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVG GLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT LACFGLAREGNHKPIDYLNPP


    Database link: P05089

Properties

Applications

Our Abpromise guarantee covers the use of ab201580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.
WB 1/1000 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Pathway

    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Involvement in disease

    Defects in ARG1 are the cause of argininemia (ARGIN) [MIM:207800]; also known as hyperargininemia. Argininemia is a rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia, progressive spastic quadriplegia.
  • Sequence similarities

    Belongs to the arginase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • A I antibody
    • Al antibody
    • ARG 1 antibody
    • arg1 antibody
    • ARGI1_HUMAN antibody
    • Arginase 1 antibody
    • Arginase liver antibody
    • Arginase type I antibody
    • Arginase, liver antibody
    • Arginase-1 antibody
    • Arginase1 antibody
    • Liver type arginase antibody
    • Liver-type arginase antibody
    • Type I arginase antibody
    see all

References

ab201580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up