Overview

  • Product name

  • Description

    Rabbit polyclonal to liver FABP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human liver FABP aa 1-127.
    Sequence:

    MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF TITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS VTELNGDIITNTMTLGDIVFKRISKRI


    Database link: P07148

  • Positive control

    • IHC-P: Mouse liver tissue. WB: HepG2 whole cell lysate (ab7900). IHC-Fr: Rat kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab227066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 14 kDa.
IHC-P 1/100 - 1/1000.
IHC-Fr 1/100 - 1/1000.

Target

  • Function

    Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FABP 1 antibody
    • FABP1 antibody
    • FABPL antibody
    • FABPL_HUMAN antibody
    • Fatty Acid Binding Protein 1 antibody
    • Fatty acid binding protein 1 liver antibody
    • Fatty Acid Binding Protein antibody
    • Fatty acid-binding protein 1 antibody
    • Fatty acid-binding protein antibody
    • Fatty acid-binding protein liver antibody
    • L FABP antibody
    • L-FABP antibody
    • liver antibody
    • Liver-type fatty acid-binding protein antibody
    see all

Images

  • Anti-liver FABP antibody (ab227066) at 1/1000 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate at 30 µg

    Secondary
    HRP-conjugated anti-rabbit IgG

    Predicted band size: 14 kDa



    15% SDS-PAGE gel.

  • Paraffin-embedded mouse liver tissue stained for liver FABP using ab227066 at 1/500 dilution in immunohistochemical analysis.

  • Frozen section of rat kidney tissue stained for liver FABP using ab227066 at 1/200 dilution in immunohistochemical analysis.

References

ab227066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up