For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    livin-antibody-oti1b10-ab236500.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular Survivin / IAPs
Share by email

Anti-Livin antibody [OTI1B10] (ab236500)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Livin antibody [OTI1B10] (ab236500)
  • Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)
  • Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)
  • Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)
  • Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)

Key features and details

  • Mouse monoclonal [OTI1B10] to Livin
  • Suitable for: WB, ICC/IF, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Protein
Product image
Recombinant Human Livin protein (ab87179)

View more associated products

Overview

  • Product name

    Anti-Livin antibody [OTI1B10]
    See all Livin primary antibodies
  • Description

    Mouse monoclonal [OTI1B10] to Livin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Livin aa 1-280. Produced in HEK293T cells (NP_071444).
    Sequence:

    MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDH VDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLT AEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPS CQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPE LPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCG HLVCAECAPGLQLCPICRAPVRSRVRTFLS


    Database link: Q96CA5-2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: pCMV6-ENTRY Livin cDNA transfected HEK-293T cell lysate. Flow Cyt: Jurkat and HeLa cells. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY Livin; HeLa cells.
  • General notes

    Clone OTI1B10 (formerly 1B10).

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1B10
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Apoptosis
    • Intracellular
    • Survivin / IAPs
    • Cancer
    • Invasion/microenvironment
    • Apoptosis
    • Death receptors & ligands
    • IAPs
    • Cancer
    • Cell Death
    • Apoptosis
    • Receptors
    • Death receptors & ligands
    • IAPs

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant Human Livin protein (ab87179)

Applications

Our Abpromise guarantee covers the use of ab236500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 33 kDa.
ICC/IF 1/100.
Flow Cyt 1/100.

Target

  • Function

    Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.
  • Tissue specificity

    Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in fetal kidney, heart and spleen, and at lower levels in adult brain, skeletal muscle and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the IAP family.
    Contains 1 BIR repeat.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Nucleus. Cytoplasm. Nuclear, and in a filamentous pattern throughout the cytoplasm.
  • Target information above from: UniProt accession Q96CA5 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 79444 Human
    • Omim: 605737 Human
    • SwissProt: Q96CA5 Human
    • Unigene: 256126 Human
    • Alternative names

      • Baculoviral IAP repeat containing 7 antibody
      • Baculoviral IAP repeat containing protein 7 antibody
      • Baculoviral IAP repeat-containing protein 7 antibody
      • BIRC 7 antibody
      • birc7 antibody
      • BIRC7_HUMAN antibody
      • KIAP antibody
      • Kidney inhibitor of apoptosis protein antibody
      • Livin antibody
      • Livin inhibitor of apotosis antibody
      • Melanoma inhibitor of apoptosis protein antibody
      • ML IAP antibody
      • ML-IAP antibody
      • MLIAP antibody
      • RING finger protein 50 antibody
      • RNF 50 antibody
      • RNF50 antibody
      see all

    Images

    • Western blot - Anti-Livin antibody [OTI1B10] (ab236500)
      Western blot - Anti-Livin antibody [OTI1B10] (ab236500)
      All lanes : Anti-Livin antibody [OTI1B10] (ab236500) at 1/2000 dilution

      Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
      Lane 2 : pCMV6-ENTRY Livin cDNA transfected HEK-293T cell lysate

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 33 kDa

    • Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)
      Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)

      Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling Livin with ab236500 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

    • Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)
      Flow Cytometry - Anti-Livin antibody [OTI1B10] (ab236500)

      Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling Livin with ab236500 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

    • Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)
      Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)

      COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY Livin stained for Livin (green) using ab236500 at 1/100 dilution in ICC/IF.

    • Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)
      Immunocytochemistry/ Immunofluorescence - Anti-Livin antibody [OTI1B10] (ab236500)

      HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Livin (green) using ab236500 at 1/100 dilution in ICC/IF.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab236500? Please let us know so that we can cite the reference in this datasheet.

    ab236500 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab236500.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.