Anti-Livin antibody [OTI1B10] (ab236500)
Key features and details
- Mouse monoclonal [OTI1B10] to Livin
- Suitable for: WB, ICC/IF, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Livin antibody [OTI1B10]
See all Livin primary antibodies -
Description
Mouse monoclonal [OTI1B10] to Livin -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Livin aa 1-280. Produced in HEK293T cells (NP_071444).
Sequence:MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDH VDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLT AEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPS CQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPE LPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCG HLVCAECAPGLQLCPICRAPVRSRVRTFLS
Database link: Q96CA5-2 -
Positive control
- WB: pCMV6-ENTRY Livin cDNA transfected HEK-293T cell lysate. Flow Cyt: Jurkat and HeLa cells. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY Livin; HeLa cells.
-
General notes
Clone OTI1B10 (formerly 1B10).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI1B10 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab236500 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000. Predicted molecular weight: 33 kDa. | |
ICC/IF | 1/100. | |
Flow Cyt | 1/100. |
Target
-
Function
Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis. -
Tissue specificity
Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in fetal kidney, heart and spleen, and at lower levels in adult brain, skeletal muscle and peripheral blood leukocytes. -
Sequence similarities
Belongs to the IAP family.
Contains 1 BIR repeat.
Contains 1 RING-type zinc finger. -
Cellular localization
Nucleus. Cytoplasm. Nuclear, and in a filamentous pattern throughout the cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 79444 Human
- Omim: 605737 Human
- SwissProt: Q96CA5 Human
- Unigene: 256126 Human
-
Alternative names
- Baculoviral IAP repeat containing 7 antibody
- Baculoviral IAP repeat containing protein 7 antibody
- Baculoviral IAP repeat-containing protein 7 antibody
see all
Images
-
All lanes : Anti-Livin antibody [OTI1B10] (ab236500) at 1/2000 dilution
Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : pCMV6-ENTRY Livin cDNA transfected HEK-293T cell lysate
Lysates/proteins at 5 µg per lane.
Predicted band size: 33 kDa -
Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling Livin with ab236500 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).
-
Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling Livin with ab236500 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).
-
COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY Livin stained for Livin (green) using ab236500 at 1/100 dilution in ICC/IF.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Livin (green) using ab236500 at 1/100 dilution in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236500 has not yet been referenced specifically in any publications.