Lixisenatide, peptidic GLP-1 receptor agonist (ab231358)

Overview

  • Product name

    Lixisenatide, peptidic GLP-1 receptor agonist
  • Description

    Short acting, potent and selective peptidic GLP-1 receptor agonist
  • Biological description

    Lixisenatide is a short acting, potent and selective short peptide-based GLP-1 receptor agonist. The in vivo half-life is  2-4 hours. Displays an IC50 of 1.4 nM at the human GLP-1 receptor in in vitro binding assays. Produces a dose-dependent reduction in blood glucose levels in animal models. Preserves the pancreatic responsiveness of diabetic animals.

  • Purity

    > 99%
  • CAS Number

    320367-13-3
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4858.56
  • Molecular formula

    C215H347N61O65S
  • Sequence

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 (Modifications: C-terminal amide)
  • PubChem identifier

    90472060
  • Storage instructions

    Shipped at 4°C. Store at -20°C.
  • Solubility overview

    soluble in water to 100 mg/mL .

  • Source

    Synthetic

References

This product has been referenced in:

  • Barnett AH Lixisenatide: evidence for its potential use in the treatment of type 2 diabetes. Core Evid 6:67-79 (2011). Read more (PubMed: 22022289) »
  • Werner U  et al. Pharmacological profile of lixisenatide: A new GLP-1 receptor agonist for the treatment of type 2 diabetes. Regul Pept 164:58-64 (2010). Read more (PubMed: 20570597) »
  • Thorkildsen C  et al. Glucagon-like peptide 1 receptor agonist ZP10A increases insulin mRNA expression and prevents diabetic progression in db/db mice. J Pharmacol Exp Ther 307:490-6 (2003). Read more (PubMed: 12975499) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up