Overview

  • Product name

  • Description

    Rabbit polyclonal to LLGL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human LLGL2 aa 251-505.
    Sequence:

    DGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIF QGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDP YALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKL WERIIAAGSRQNAHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFW DASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRKVGSFDPYS DDPRL


    Database link: Q6P1M3

  • Positive control

    • ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.
  • Sequence similarities

    Belongs to the WD repeat L(2)GL family.
    Contains 14 WD repeats.
  • Post-translational
    modifications

    Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.
  • Cellular localization

    Cytoplasm. Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • HGL antibody
    • Human giant larvae homolog antibody
    • L2GL2 antibody
    • L2GL2_HUMAN antibody
    • Lethal 2 giant larvae protein homolog 2 antibody
    • Lethal giant larvae homolog 2 antibody
    • Lethal(2) giant larvae protein homolog 2 antibody
    • LGL2 antibody
    • LLGL2 antibody
    see all

Images

  • MCF7 (Human breast adenocarcinoma cell line) cells labeling LLGL2 using ab234810 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) secondary antibody. 

References

ab234810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up