Overview

  • Product name

    Anti-LMF1 antibody - N-terminal
    See all LMF1 primary antibodies
  • Description

    Rabbit polyclonal to LMF1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide within Human LMF1 aa 311-360 (N terminal). The exact sequence is proprietary.
    Sequence:

    LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG


    Database link: Q96S06

  • Positive control

    • Human lung tumor lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Involved in the maturation of specific proteins in the endoplasmic reticulum. Required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Each LMF1 molecule chaperones 50 or more molecules of LPL.
  • Involvement in disease

    Combined lipase deficiency
  • Sequence similarities

    Belongs to the lipase maturation factor family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW822050 antibody
    • C16orf26 antibody
    • cld antibody
    • FLJ12681 antibody
    • FLJ22302 antibody
    • HMFN1876 antibody
    • JFP11 antibody
    • Lipase maturation factor 1 antibody
    • LMF1 antibody
    • LMF1_HUMAN antibody
    • RGD1310180 antibody
    • TMEM112 antibody
    • TMEM112A antibody
    • Transmembrane protein 112 antibody
    see all

Images

  • Anti-LMF1 antibody - N-terminal (ab178358) at 1 µg/ml + Human lung tumor lysate at 10 µg

    Predicted band size: 65 kDa

References

ab178358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up