Anti-LMO2 antibody (ab219995)

Submit a review Submit a question
Immunocytochemistry/ Immunofluorescence - Anti-LMO2 antibody (ab219995)

    Key features and details

    • Rabbit polyclonal to LMO2
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-LMO2 antibody
      See all LMO2 primary antibodies

    • Description

      Rabbit polyclonal to LMO2

    • Host species

      Rabbit

    • Tested applications

      Suitable for: ICC/IFmore details

    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Cow, Xenopus laevis, Zebrafish, Xenopus tropicalis

    • Immunogen

      Recombinant fragment corresponding to Human LMO2 aa 8-157.
      Sequence:

      KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSC DLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMT MRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM


      Database link: P25791
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • REH cells.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid

    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
    • Concentration information loading...

    • Purity

      Immunogen affinity purified

    • Clonality

      Polyclonal

    • Isotype

      IgG

    • Research areas

    Applications

    Our Abpromise guarantee covers the use of ab219995 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 0.25 - 2 µg/ml.

    Target

    • Function

      Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.

    • Involvement in disease

      Note=A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD.

    • Sequence similarities

      Contains 2 LIM zinc-binding domains.

    • Domain

      The second LIM zinc-binding domain interacts with KDM5A.

    • Cellular localization

      Nucleus.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • Cysteine rich protein TTG 2 antibody
      • Cysteine rich protein TTG2 antibody
      • Cysteine-rich protein TTG-2 antibody
      • LIM domain only 2 (rhombotin like 1) antibody
      • LIM domain only 2 antibody
      • LIM domain only protein 2 antibody
      • LMO 2 antibody
      • LMO-2 antibody
      • lmo2 antibody
      • RBTN 2 antibody
      • RBTN L1 antibody
      • RBTN2 antibody
      • RBTN2_HUMAN antibody
      • RBTNL 1 antibody
      • RBTNL1 antibody
      • RHOM 2 antibody
      • RHOM2 antibody
      • Rhombotin 2 antibody
      • Rhombotin like 1 antibody
      • Rhombotin-2 antibody
      • Rhombotin2 antibody
      • T cell translocation gene 2 antibody
      • T cell translocation protein 2 antibody
      • T-cell translocation protein 2 antibody
      • TTG 2 antibody
      • TTG2 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-LMO2 antibody (ab219995)
      Immunocytochemistry/ Immunofluorescence - Anti-LMO2 antibody (ab219995)

      Immunofluorescent analysis of REH cells (PFA-fixed/Triton X-100 permeabilized) labeling LMO2 with ab219995 at 4 µg/mL (green).

    References (0)

    Publishing research using ab219995? Please let us know so that we can cite the reference in this datasheet.

    ab219995 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab219995.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com