Anti-LMO2 antibody (ab219995)
Key features and details
- Rabbit polyclonal to LMO2
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LMO2 antibody
See all LMO2 primary antibodies -
Description
Rabbit polyclonal to LMO2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Xenopus laevis, Zebrafish, Xenopus tropicalis -
Immunogen
Recombinant fragment corresponding to Human LMO2 aa 8-157.
Sequence:KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSC DLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMT MRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
Database link: P25791 -
Positive control
- REH cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab219995 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. -
Involvement in disease
Note=A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD. -
Sequence similarities
Contains 2 LIM zinc-binding domains. -
Domain
The second LIM zinc-binding domain interacts with KDM5A. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 614876 Cow
- Entrez Gene: 4005 Human
- Entrez Gene: 16909 Mouse
- Entrez Gene: 108713784 Xenopus laevis
- Entrez Gene: 394388 Xenopus laevis
- Entrez Gene: 496679 Xenopus tropicalis
- Entrez Gene: 30332 Zebrafish
- Omim: 180385 Human
see all -
Alternative names
- Cysteine rich protein TTG 2 antibody
- Cysteine rich protein TTG2 antibody
- Cysteine-rich protein TTG-2 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab219995 has not yet been referenced specifically in any publications.