Anti-LMO4 antibody (ab229226)
Key features and details
- Rabbit polyclonal to LMO4
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LMO4 antibody
See all LMO4 primary antibodies -
Description
Rabbit polyclonal to LMO4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow -
Immunogen
Recombinant full length protein corresponding to Human LMO4 aa 1-165.
Sequence:MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKC SCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELV MRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHL NSLQSNPLLPDQKVC
Database link: P61968 -
Positive control
- WB: LMO4-transfected HEK-293T whole cell extract. IHC-P: Human breast carcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.025% Proclin 300
Constituents: 79% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab229226 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/1000. | |
WB | 1/1000 - 1/10000. Predicted molecular weight: 18 kDa. |
Target
-
Function
Probable transcriptional factor. -
Sequence similarities
Contains 2 LIM zinc-binding domains. - Information by UniProt
-
Database links
- Entrez Gene: 614212 Cow
- Entrez Gene: 8543 Human
- Entrez Gene: 16911 Mouse
- Omim: 603129 Human
- SwissProt: Q3SWZ8 Cow
- SwissProt: P61968 Human
- SwissProt: P61969 Mouse
- Unigene: 436792 Human
see all -
Alternative names
- Breast tumor autoantigen antibody
- LIM domain only 4 antibody
- LIM domain only protein 4 antibody
see all
Images
-
All lanes : Anti-LMO4 antibody (ab229226) at 1/5000 dilution
Lane 1 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract
Lane 2 : LMO4-transfected HEK-293T whole cell extract
Lysates/proteins at 30 µg per lane.
Predicted band size: 18 kDa12% SDS-PAGE gel.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LMO4 antibody (ab229226)
Paraffin-embedded human breast carcinoma tissue stained for LMO4 using ab229226 at 1/500 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab229226 has not yet been referenced specifically in any publications.