Overview

  • Product name

  • Description

    Rabbit polyclonal to LMO7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LMO7 aa 695-838.
    Sequence:

    KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAK WKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQK STVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY


    Database link: Q8WWI1

  • Positive control

    • WB: HeLa whole cell lysate (ab150035). ICC/IF: A431 cells. IHC-P: Human duodenum, skeletal muscle, testis and uterine cervix tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab224113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 154,158,185,191,193 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Widely expressed. Isoform 2 and isoform 4 are predominantly expressed in brain.
  • Sequence similarities

    Contains 1 CH (calponin-homology) domain.
    Contains 1 LIM zinc-binding domain.
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • F box only protein 20 antibody
    • F box protein Fbx20 antibody
    • F-box only protein 20 antibody
    • FBX20 antibody
    • FBXO20 antibody
    • HGNC13591 antibody
    • KIAA0858 antibody
    • LIM domain only 7 antibody
    • LIM domain only protein 7 antibody
    • LMO 7 antibody
    • LMO-7 antibody
    • LMO7 antibody
    • LMO7_HUMAN antibody
    • LOMP antibody
    • LOMP protein antibody
    • Zinc finger domain containing protein antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for LMO7 (green) using ab224113 at 4 µg/ml in ICC/IF.

  • Anti-LMO7 antibody (ab224113) at 1/250 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 154,158,185,191,193 kDa

  • Paraffin-embedded human duodenum tissue stained for LMO7 using ab224113 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for LMO7 using ab224113 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for LMO7 using ab224113 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human uterine cervix tissue stained for LMO7 using ab224113 at 1/200 dilution in immunohistochemical analysis.

References

ab224113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up