Anti-LMOD1 antibody (ab244415)
Key features and details
- Rabbit polyclonal to LMOD1
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LMOD1 antibody
See all LMOD1 primary antibodies -
Description
Rabbit polyclonal to LMOD1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human LMOD1 aa 55-126.
Sequence:TEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEER GRDASKKALGPRRDSDLGKEPK
Database link: P29536 -
Positive control
- IHC-P: Human prostate, smooth muscle and colon tissues. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244415 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 67 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Smooth muscle (heart, skeletal muscle, colon and small intestine), a subset of striated muscle fibers, and at low level in thyroid. -
Sequence similarities
Belongs to the tropomodulin family.
Contains 1 WH2 domain. -
Cellular localization
Cytoplasm. Cytoplasm > cytoskeleton. - Information by UniProt
-
Database links
- Entrez Gene: 25802 Human
- Omim: 602715 Human
- SwissProt: P29536 Human
- Unigene: 519075 Human
-
Alternative names
- 1D antibody
- 64 kDa autoantigen 1D antibody
- 64 kDa autoantigen 1D3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LMOD1 antibody (ab244415)Paraffin-embedded human smooth muscle tissue stained for LMOD1 using ab244415 at 1/50 dilution in immunohistochemical analysis.
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for LMOD1 (green) using ab244415 at 4 µg/ml in ICC/IF.
-
All lanes : Anti-LMOD1 antibody (ab244415) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 67 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LMOD1 antibody (ab244415)Paraffin-embedded human colon tissue stained for LMOD1 using ab244415 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LMOD1 antibody (ab244415)Paraffin-embedded human liver tissue stained for LMOD1 using ab244415 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LMOD1 antibody (ab244415)Paraffin-embedded human prostate tissue stained for LMOD1 using ab244415 at 1/50 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244415 has not yet been referenced specifically in any publications.