Overview

  • Product name

  • Description

    Rabbit polyclonal to LMTK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human LMTK2 aa 675-725. The exact sequence is proprietary. NP_055731.2
    Sequence:

    NPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFL F


    Database link: Q8IWU2

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab186138 was affinity purified using an epitope specific to LMTK2 immobilized on a solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 165 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function

      Phosphorylates PPP1C, phosphorylase b and CFTR.
    • Tissue specificity

      Mainly expressed in skeletal muscle, and weakly in brain and pancreas.
    • Sequence similarities

      Belongs to the protein kinase superfamily. Tyr protein kinase family.
      Contains 1 protein kinase domain.
    • Post-translational
      modifications

      Autophosphorylated. Phosphorylated.
    • Cellular localization

      Membrane.
    • Information by UniProt
    • Database links

    • Alternative names

      • AATYK 2 antibody
      • AATYK2 antibody
      • Apoptosis associated tyrosine kinase 2 antibody
      • Apoptosis-associated tyrosine kinase 2 antibody
      • Brain enriched kinase antibody
      • Brain-enriched kinase antibody
      • BREK antibody
      • CDK5/p35 regulated kinase antibody
      • CDK5/p35-regulated kinase antibody
      • CPRK antibody
      • cyclin-dependent kinase 5/p35-regulated kinase antibody
      • FLJ46659 antibody
      • hBREK antibody
      • KIAA1079 antibody
      • Kinase phosphatase inhibitor 2 antibody
      • Kinase/phosphatase/inhibitor 2 antibody
      • KPI 2 antibody
      • KPI-2 antibody
      • KPI2 antibody
      • Lemur tyrosine kinase 2 antibody
      • LMR 2 antibody
      • LMR2 antibody
      • LMTK 2 antibody
      • Lmtk2 antibody
      • LMTK2_HUMAN antibody
      • PPP1R100 antibody
      • protein phosphatase 1, regulatory subunit 100 antibody
      • Serine/threonine protein kinase KPI 2 antibody
      • Serine/threonine protein kinase KPI2 antibody
      • Serine/threonine protein kinase LMTK 2 antibody
      • Serine/threonine protein kinase LMTK2 antibody
      • Serine/threonine-protein kinase KPI-2 antibody
      • Serine/threonine-protein kinase LMTK2 antibody
      see all

    Images

    • All lanes : Anti-LMTK2 antibody (ab186138) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysates
      Lane 2 : 293T whole cell lysates
      Lane 3 : Jurkat whole cell lysates

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 165 kDa


      Exposure time: 3 minutes

    References

    ab186138 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab186138.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up