Overview

  • Product name

  • Description

    Rabbit polyclonal to LMX1b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, Zebrafish
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide within Human LMX1b aa 324-380 (C terminal). The exact sequence is proprietary.
    Sequence:

    QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS


    Database link: O60663

  • Positive control

    • Skeletal Muscle (Human) Whole Cell Lysate - fetal normal tissue (ab29331) can be used as a positive control in WB.

Properties

Applications

Our Abpromise guarantee covers the use of ab66941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr Use at an assay dependent concentration.

Target

  • Function

    Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels.
  • Tissue specificity

    Expressed in most tissues. Highest levels in testis, thyroid, duodenum, skeletal muscle, and pancreatic islets.
  • Involvement in disease

    Defects in LMX1B are the cause of nail-patella syndrome (NPS) [MIM:161200]; also known as onychoosteodysplasia. NPS is a disease that cause abnormal skeletal patterning and renal dysplasia.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • LIM homeo box transcription factor 1 beta antibody
    • LIM homeobox transcription factor 1 beta antibody
    • LIM homeobox transcription factor 1-beta antibody
    • LIM-homeobox protein 1.2 antibody
    • LIM/homeobox protein 1.2 antibody
    • LIM/homeobox protein LMX1B antibody
    • LMX 1.2 antibody
    • LMX-1.2 antibody
    • LMX1.2 antibody
    • LMX1B antibody
    • LMX1B_HUMAN antibody
    • MGC138325 antibody
    • MGC142051 antibody
    • NPS 1 antibody
    • NPS1 antibody
    see all

Images

  • Ab66941 (2.5 ug/ml) staining of LMX1b in fetal muscle lysate by WB.

References

This product has been referenced in:

  • Márquez-Valadez B  et al. The Systemic Administration of the Histamine H1 Receptor Antagonist/Inverse Agonist Chlorpheniramine to Pregnant Rats Impairs the Development of Nigro-Striatal Dopaminergic Neurons. Front Neurosci 13:360 (2019). Read more (PubMed: 31040765) »
See 1 Publication for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-2 of 2 Abreviews

Application
Immunohistochemistry (Frozen sections)
Sample
Zebrafish Tissue sections (heart, fin)
Specification
heart, fin
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.1% Tween 20 in PBS
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 37°C

Abcam user community

Verified customer

Submitted Jul 05 2010

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Embryonic brain)
Specification
Embryonic brain
Fixative
Paraformaldehyde
Permeabilization
No
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 26 2009

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up