Overview

  • Product name

  • Description

    Rabbit polyclonal to LMX1b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, Zebrafish
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide within Human LMX1b aa 324-380 (C terminal). The exact sequence is proprietary.
    Sequence:

    QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS


    Database link: O60663

  • Positive control

    • Skeletal Muscle (Human) Whole Cell Lysate - fetal normal tissue (ab29331) can be used as a positive control in WB.

Properties

Applications

Our Abpromise guarantee covers the use of ab66941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr Use at an assay dependent concentration.

Target

  • Function

    Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels.
  • Tissue specificity

    Expressed in most tissues. Highest levels in testis, thyroid, duodenum, skeletal muscle, and pancreatic islets.
  • Involvement in disease

    Defects in LMX1B are the cause of nail-patella syndrome (NPS) [MIM:161200]; also known as onychoosteodysplasia. NPS is a disease that cause abnormal skeletal patterning and renal dysplasia.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • LIM homeo box transcription factor 1 beta antibody
    • LIM homeobox transcription factor 1 beta antibody
    • LIM homeobox transcription factor 1-beta antibody
    • LIM-homeobox protein 1.2 antibody
    • LIM/homeobox protein 1.2 antibody
    • LIM/homeobox protein LMX1B antibody
    • LMX 1.2 antibody
    • LMX-1.2 antibody
    • LMX1.2 antibody
    • LMX1B antibody
    • LMX1B_HUMAN antibody
    • MGC138325 antibody
    • MGC142051 antibody
    • NPS 1 antibody
    • NPS1 antibody
    see all

Images

  • Ab66941 (2.5 ug/ml) staining of LMX1b in fetal muscle lysate by WB.

References

This product has been referenced in:

  • Márquez-Valadez B  et al. The Systemic Administration of the Histamine H1 Receptor Antagonist/Inverse Agonist Chlorpheniramine to Pregnant Rats Impairs the Development of Nigro-Striatal Dopaminergic Neurons. Front Neurosci 13:360 (2019). Read more (PubMed: 31040765) »
See 1 Publication for this product

Customer reviews and Q&As

1-7 of 7 Q&A

Answer

Thank you for your phone call.

This antibody was validated on frozen sections by a customer:

https://www.abcam.com/index.html?datasheet=66941&tab=abreviews&intabreviewid=19533

We would recommend a light fixation, such as 4% PFA for less than 20 minutes, or ice cold acetone or methanol.

This antibody will be guaranteed for use in IHC-Fr, so if you are at all unsatisfied with your results, please let us know within six months and we will be happy to offer you a free of charge replacement, credit, or refund. Please let me know if you need any additional information or assistance.

Read More

Question

This email has 2 sections:

A recap of the complaint

The respondent’s survey results (section-by-section)
Recap of the complaint

Date(s) submitted: 17 May 2012

Catalog number(s): 66941

Product(s): Rabbit polyclonal to LMX1b

CCEID: 3774668
Survey results
Telephone section
Q. Did you contact Abcam's Scientific Support by telephone in reference to this complaint?
A. No
Q. Was it clear from the phone options which number you needed to press to get your issue resolved?
A.

Protocol advice section
Q. Did Abcam's Scientific Support give you protocol advice?
A.Yes
Q. How did you feel about being given protocol advice?
A.I was not expecting to be given protocol advice, but was happy to receive this
Q. Did the product work successfully after following the advice?
A.No
Q. Why have you not tried the protocol advice? (Select all that apply.)

Free of charge replacement section
Q. Did Abcam's Scientific Support give you a free of charge replacement?
A. Yes

Q. Did the replacement product work successfully?
A.I have not tried it yet
Credit note / refund section
Q. Did Abcam's Scientific Support give you a credit note or a refund?
A.No

Q. Would you have preferred a different outcome from receiving a credit note or refund?
A.
Overall satisfaction section
Q. How satisfied are you with how the complaint was handled?
A.Very satisfied
Q. Could we have done anything to better resolve the problem?
A.no
Q. Would you mind if our scientific support team contacted you to better understand what happened and reach an agreeable solution?
A.No, I would not mind
Q. Please provide a phone number or email address where we can reach you.
A.
Q. Please share with us any final thoughts you may have about Abcam, the complaints process, or our products.

Read More
Answer

Your details has been forwarded to me by my colleague.

I hope the new vial will work for you; in case of any problem please do not hesitate to contact me.

Best of luck with you research!

Read More

Answer

Thank you for sending your protocol. I am sorry to see that this antibody and the LMX1a antibody ab31006 are both giving negative IHC results.

I think your protocol is good and I would expect to see a positive result for ab66941, though we have had mixed reports, as you can see from the customer reviews shown on the datasheet. There is a question of specificity according to one of the reviewers but the western blot data suggests the antibody is specific. For both reviewers, however, at least some staining was evident..

Can you please confirm that the species of your sample is mouse? Are you confident that the secondary antibody will recognize rabbit IgG, and that it is effective with other antibodies?

The LMX1a antibody was found some years ago to be ineffective for IHC. We unfortunately do not have another antibody against this protein that has been shown to be capable of staining tissue sections.

Can you please tell me approximately when you placed your order for the LXM1b antibody? I am willing to discuss replacing it,, as IHC of mouse tissue is covered by our guarantee, though our choices of good alternatives is very limited.

Read More

Answer

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement with the order number 1099794, (ab70174).

To check the status of the order please contact our Customer Service team and reference this number.

Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know.

I wish you the best of luck with your research.

PS: Please do not forget to submit an Abreview.

Read More

Answer

Thank you for sending the questionnaire.

It is difficult to guess, the identity of band at 30kDa which is consistent in all lysates. The only lysate which shows correct band size is LMX1B trans-fected Hek 293 cells. In regards to other lysates I am sorry we are unable to determine the identity of extra bands; you may need further optimization of the application. My suggestions for optimization would be

- Include negative control i.e. lysates without primary antibody
- Prepare lystes with 80-90% cell confluency
- Keep the lysis buffer at 4C when lysing the cells
- Boil the lysates in sample buffer for 10 minutes at 100C.

Please note that the purchase of this antibody is out of Abpromise guarantee. However we are happy to help as far as we can.

I hope these suggestions will help to improve results. If these doesn't please let me know, I will then try to replace the antibody free of charge.

Read More

Answer

Thank you for contacting us.

I am sorry to hear you are experiencing difficulties with one of our products. We take product complaints very seriously, and investigate every product that we feel may not be performing correctly.

I am attaching our questionnaire so that we can gather further information regarding the samples tested and the protocol used. Once we receive the completed questionnaire, we will look at the protocol and see if there are any suggestions we can make that may improve the results. This information will also allow us to investigate this case internally and initiate additional testing where necessary. If the product was purchased in the last six months and is being used according to our Abpromise, we would be happy to replace or refund the antibody.

I look forward to receiving your reply.

PS: We are not sure which other company is showing this image however this antibody and other 3, ab70174, ab82835 and ab129306 are fully guaranteed for detection of LMX1B with human lysates.

We unfortunately have image for this antibody only.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up