Overview

  • Product name

    Anti-LNPEP antibody - N-terminal
    See all LNPEP primary antibodies
  • Description

    Rabbit polyclonal to LNPEP - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Pig, Chimpanzee, Rhesus monkey, Common marmoset
  • Immunogen

    Synthetic peptide within Human LNPEP aa 1-50 (N terminal). The exact sequence is proprietary. NP_005566.2.
    Sequence:

    MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRG


    Database link: Q9UIQ6

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.
  • General notes

    Previously labelled as Leucyl-cystinyl aminopeptidase. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab190255 was affinity purified using an epitope specific to LNPEP immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 117 kDa.

Target

  • Function

    Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be involved in the inactivation of neuronal peptides in the brain. Cleaves Met-enkephalin and dynorphin. Binds angiotensin IV and may be the angiotensin IV receptor in the brain.
  • Tissue specificity

    Highly expressed in placenta, heart, kidney and small intestine. Detected at lower levels in neuronal cells in the brain, in skeletal muscle, spleen, liver, testes and colon.
  • Sequence similarities

    Belongs to the peptidase M1 family.
  • Post-translational
    modifications

    The pregnancy serum form is derived from the membrane-bound form by proteolytic processing.
    N-glycosylated.
  • Cellular localization

    Cell membrane. In brain only the membrane-bound form is found. The protein resides in intracellular vesicles together with GLUT4 and can then translocate to the cell surface in response to insulin and/or oxytocin. Localization may be determined by dileucine internalization motifs, and/or by interaction with tankyrases and Secreted. During pregnancy serum levels are low in the first trimester, rise progressively during the second and third trimester and decrease rapidly after parturition.
  • Information by UniProt
  • Database links

  • Alternative names

    • angiotensin IV receptor antibody
    • AT (4) receptor antibody
    • CAP antibody
    • Cystinyl aminopeptidase antibody
    • insulin regulated aminopeptidase antibody
    • insulin regulated membrane aminopeptidase antibody
    • insulin responsive aminopeptidase antibody
    • Insulin-regulated membrane aminopeptidase antibody
    • Insulin-responsive aminopeptidase antibody
    • IRAP antibody
    • LCAP_HUMAN antibody
    • Leucyl-cystinyl aminopeptidase antibody
    • LNPEP antibody
    • OTase antibody
    • Oxytocinase antibody
    • P-LAP antibody
    • Placental leucine aminopeptidase antibody
    • PLAP antibody
    • pregnancy serum form antibody
    • vasopressinase antibody
    see all

Images

  • Detection of LNPEP by Western Blot of Immunoprecipitate.
    ab190255 at 1 µg/ml labeling LNPEP in Jurkat whole cell lysate immunoprecipitated using ab190255 at 6 µg/reaction (1 mg/IP; 20% of IP loaded/lane). Detection: Chemiluminescence with exposure time of 30 seconds.

  • All lanes : Anti-LNPEP antibody - N-terminal (ab190255) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 117 kDa


    Exposure time: 3 minutes

References

ab190255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up