Anti-LOC134147/CMBL antibody (ab224534)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-LOC134147/CMBL antibody
See all LOC134147/CMBL primary antibodies -
Description
Rabbit polyclonal to LOC134147/CMBL -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant fragment corresponding to Human LOC134147/CMBL aa 5-81.
Sequence:AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGW QLPNTRYIADMISGNGYTTIVPDFFVG
Database link: Q96DG6 -
Positive control
- WB: Human liver tissue lysate. IHC-P: Human cerebellum tissue.
-
General notes
This product was previously labelled as LOC134147
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224534 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 28 kDa. | |
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Cysteine hydrolase. Can convert the prodrug olmesartan medoxomil into its pharmacologically active metabolite olmerstatan, an angiotensin receptor blocker, in liver and intestine. May also activate beta-lactam antibiotics faropenem medoxomil and lenampicillin. -
Tissue specificity
Widely expressed, with highest levels in liver, followed by kidney, small intestine and colon. Present in liver and intestine (at protein level). -
Sequence similarities
Belongs to the dienelactone hydrolase family. -
Cellular localization
Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 134147 Human
- Entrez Gene: 100172338 Orangutan
- SwissProt: Q96DG6 Human
- SwissProt: Q5RBU3 Orangutan
- Unigene: 192586 Human
-
Alternative names
- Carboxymethylenebutenolidase homolog (Pseudomonas) antibody
- Carboxymethylenebutenolidase homolog antibody
- cmbl antibody
see all
Images
-
Western blot - Anti-LOC134147/CMBL antibody (ab224534)All lanes : Anti-LOC134147/CMBL antibody (ab224534) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Predicted band size: 28 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LOC134147/CMBL antibody (ab224534)Paraffin-embedded human cerebellum tissue stained for LOC134147/CMBL using ab224534 at 1/1000 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab224534 has not yet been referenced specifically in any publications.
