Anti-LOC134147/CMBL antibody (ab224534)
Key features and details
- Rabbit polyclonal to LOC134147/CMBL
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LOC134147/CMBL antibody
See all LOC134147/CMBL primary antibodies -
Description
Rabbit polyclonal to LOC134147/CMBL -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human LOC134147/CMBL aa 5-81.
Sequence:AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGW QLPNTRYIADMISGNGYTTIVPDFFVG
Database link: Q96DG6 -
Positive control
- WB: Human liver tissue lysate. IHC-P: Human cerebellum tissue.
-
General notes
This product was previously labelled as LOC134147
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224534 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 28 kDa. | |
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Cysteine hydrolase. Can convert the prodrug olmesartan medoxomil into its pharmacologically active metabolite olmerstatan, an angiotensin receptor blocker, in liver and intestine. May also activate beta-lactam antibiotics faropenem medoxomil and lenampicillin. -
Tissue specificity
Widely expressed, with highest levels in liver, followed by kidney, small intestine and colon. Present in liver and intestine (at protein level). -
Sequence similarities
Belongs to the dienelactone hydrolase family. -
Cellular localization
Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 134147 Human
- Entrez Gene: 100172338 Orangutan
- SwissProt: Q96DG6 Human
- SwissProt: Q5RBU3 Orangutan
- Unigene: 192586 Human
-
Alternative names
- Carboxymethylenebutenolidase homolog (Pseudomonas) antibody
- Carboxymethylenebutenolidase homolog antibody
- cmbl antibody
see all
Images
-
All lanes : Anti-LOC134147/CMBL antibody (ab224534) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Predicted band size: 28 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LOC134147/CMBL antibody (ab224534)
Paraffin-embedded human cerebellum tissue stained for LOC134147/CMBL using ab224534 at 1/1000 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224534 has not yet been referenced specifically in any publications.