Overview

  • Product name

    Anti-LOC134147/CMBL antibody
    See all LOC134147/CMBL primary antibodies
  • Description

    Rabbit polyclonal to LOC134147/CMBL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human LOC134147/CMBL aa 2-245.
    Sequence:

    ANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDI FGWQLPNTRYIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKTR NAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHHLMMKYSEFRAG VSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVE YQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM


    Database link: Q96DG6

  • Positive control

    • WB: Mouse kidney and liver tissue lysate. IHC-P: Human kidney and small intestine tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as LOC134147

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cysteine hydrolase. Can convert the prodrug olmesartan medoxomil into its pharmacologically active metabolite olmerstatan, an angiotensin receptor blocker, in liver and intestine. May also activate beta-lactam antibiotics faropenem medoxomil and lenampicillin.
  • Tissue specificity

    Widely expressed, with highest levels in liver, followed by kidney, small intestine and colon. Present in liver and intestine (at protein level).
  • Sequence similarities

    Belongs to the dienelactone hydrolase family.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxymethylenebutenolidase homolog (Pseudomonas) antibody
    • Carboxymethylenebutenolidase homolog antibody
    • cmbl antibody
    • CMBL_HUMAN antibody
    • FLJ23617 antibody
    see all

Images

  • All lanes : Anti-LOC134147/CMBL antibody (ab237694) at 1/500 dilution

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human kidney tissue stained for LOC134147/CMBL with ab237694 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for LOC134147/CMBL with ab237694 at a 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for LOC134147/CMBL (Green) using ab237694 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up