Anti-LOC91614 antibody (ab174659)
- Datasheet
- References (1)
- Protocols
Overview
-
Product nameAnti-LOC91614 antibody
See all LOC91614 primary antibodies -
DescriptionRabbit polyclonal to LOC91614
-
Host speciesRabbit
-
Tested applicationsSuitable for: WB, IPmore details
-
Species reactivityReacts with: Human
Predicted to work with: Orangutan -
Immunogen
Synthetic peptide within Human LOC91614 aa 461-511. The exact sequence is proprietary. NP_001070710.1.
Sequence:SNNTEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFG D
Database link: Q96QD5 -
Positive control
- HeLa and 293T whole cell lysates.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174659 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 58 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Tissue specificityExpressed in liver.
-
Sequence similaritiesBelongs to the DEPDC7 family.
Contains 1 DEP domain. - Information by UniProt
-
Database links
- Entrez Gene: 91614 Human
- Entrez Gene: 100173116 Orangutan
- Omim: 612294 Human
- SwissProt: Q96QD5 Human
- SwissProt: Q5R8B7 Orangutan
- Unigene: 280990 Human
-
Alternative names
- DEP domain containing 7 antibody
- DEP domain containing protein 7 antibody
- DEP domain-containing protein 7 antibody
see all
Images
-
Detection of LOC91614 by Western Blot of Immunoprecipitate.
-
All lanes : Anti-LOC91614 antibody (ab174659) at 0.400000005960464 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 58 kDa
Exposure time: 3 minutes
Datasheets and documents
References
This product has been referenced in:
- Liao Z et al. DEPDC7 inhibits cell proliferation, migration and invasion in hepatoma cells. Oncol Lett 14:7332-7338 (2017). Read more (PubMed: 29344171) »