Overview

  • Product name

  • Description

    Rabbit polyclonal to LONP1/Lon
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human LONP1/Lon aa 383-524.
    Sequence:

    VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPK HVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLAR AQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP


    Database link: P36776

  • Positive control

    • WB: NIH/3T3, NBT-II, PC-12 and SK-MEL-30 cell lysate. ICC/IF: U-251 MG cells. IHC-P: Human duodenum tissue.
  • General notes

    Protein previously labeled as LONP1.

Properties

Applications

Our Abpromise guarantee covers the use of ab224316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 106 kDa.

Target

  • Function

    ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial promoters and RNA in a single-stranded, site-specific, and strand-specific manner. May regulate mitochondrial DNA replication and/or gene expression using site-specific, single-stranded DNA binding to target the degradation of regulatory proteins binding to adjacent sites in mitochondrial promoters. Endogenous substrates include mitochondrial steroidogenic acute regulatory (StAR) protein.
  • Tissue specificity

    Duodenum, heart, lung and liver, but not thymus.
  • Involvement in disease

    CODAS syndrome
  • Sequence similarities

    Belongs to the peptidase S16 family.
    Contains 1 Lon domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • hLON antibody
    • hLON ATP dependent protease antibody
    • LON antibody
    • lon peptidase 1, mitochondrial antibody
    • LON protease antibody
    • Lon protease homolog antibody
    • Lon protease like protein antibody
    • Lon protease-like protein antibody
    • LONHs antibody
    • LONM_HUMAN antibody
    • LONP antibody
    • Lonp1 antibody
    • MGC1498 antibody
    • mitochondrial antibody
    • Mitochondrial ATP dependent protease Lon antibody
    • Mitochondrial ATP-dependent protease Lon antibody
    • Mitochondrial lon peptidase 1 antibody
    • PIM1 antibody
    • Protease serine 15 antibody
    • PRSS15 antibody
    • Serine protease 15 antibody
    see all

Images

  • Anti-LONP1/Lon antibody (ab224316) at 1/100 dilution + SK-MEL-30 cell lysate

    Predicted band size: 106 kDa

  • Paraffin embedded human duodenum tissue stained for LONP1/Lon with ab224316 (1/500 dilution) in immunohistochemical analysis.

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for LONP1/Lon (green) using ab224316 (4 µg/ml) in ICC/IF.

  • All lanes : Anti-LONP1/Lon antibody (ab224316) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate

    Predicted band size: 106 kDa

References

ab224316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up