Overview

  • Product name

  • Description

    Rabbit polyclonal to LOX 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow LOX 1 aa 57-270. Expressed in E. coli. N-terminal tags.
    Sequence:

    SQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLA HKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSS GSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRK PNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTA FSICQKKANLLRAQ


    Database link: P79391

  • Positive control

    • WB: Recombinant cow LOX 1 protein. Cow thymus and spleen lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
  • Tissue specificity

    Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level.
  • Involvement in disease

    Note=Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility.
    Note=OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Domain

    The cytoplasmic region is required for subcellular sorting on the cell surface.
    The C-type lectin domain mediates the recognition and binding of oxLDL.
  • Post-translational
    modifications

    The intrachain disulfide-bonds prevent N-glycosylation at some sites.
    N-glycosylated.
  • Cellular localization

    Cell membrane. Secreted. A secreted form also exists.
  • Information by UniProt
  • Alternative names

    • C-type lectin domain family 8 member A antibody
    • CLEC8A antibody
    • hLOX 1 antibody
    • hLOX-1 antibody
    • Lectin like oxidized LDL receptor 1 antibody
    • Lectin like oxLDL receptor 1 antibody
    • Lectin type oxidized LDL receptor 1 antibody
    • Lectin-like oxidized LDL receptor 1 antibody
    • Lectin-like oxLDL receptor 1 antibody
    • Lectin-type oxidized LDL receptor 1 antibody
    • low density lipoprotein oxidized, receptor 1 antibody
    • LOX-1 antibody
    • LOXIN antibody
    • Olr1 antibody
    • OLR1_HUMAN antibody
    • Ox LDL receptor 1 antibody
    • Ox-LDL receptor 1 antibody
    • Oxidised low density lipoprotein (lectin like) receptor 1 antibody
    • Oxidized low density lipoprotein receptor 1 antibody
    • Oxidized low density lipoprotein receptor 1 soluble form antibody
    • Oxidized low-density lipoprotein receptor 1 antibody
    • OxLDL receptor 1 antibody
    • SCARE1 antibody
    • Scavenger receptor class E, member 1 antibody
    • SLOX1 antibody
    • soluble form antibody
    • SR-EI antibody
    see all

Images

  • All lanes : Anti-LOX 1 antibody (ab231204) at 2 µg/ml

    Lane 1 : Cow spleen tissue lysate
    Lane 2 : Cow thymus gland tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/1000 dilution
  • Anti-LOX 1 antibody (ab231204) at 2 µg/ml + Recombinant cow LOX 1 protein

References

ab231204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up