Overview

  • Product name

  • Description

    Rabbit polyclonal to LOXL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LOXL1 aa 106-574.
    Sequence:

    VGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSA SSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYY RPAGGGVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAP ERPYVPPPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQAHGGDP RLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLS VGSVYRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLAST AYAPEATDYDVRVLLRFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSM DEFSHYDLLDAATGKKVAEGHKASFCLEDSTCDFGNLKRYACTSHTQGLS PGCYDTYNADIDCQWIDITDVQPGNYILKVHVNPKYIVLESDFTNNVVRC NIHYTGRYVSATNCKIVQS


    Database link: Q08397

  • Positive control

    • IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    LOXL1 is a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL1 is active on elastin and collagen substrates. Genetic variations in LOXL1 are associated with risk of developing exfoliation syndrome (XFS) [MIM:177650]; also called exfoliation glaucoma (XFG). Exfoliation syndrome (XFS) is characterized by accumulation of abnormal microfibrillar deposits that line the aqueous bathed surfaces of the anterior segment of the eye. The prevalence of XFS increases with age, and a number of studies have pointed to a geographical clustering of XFS, although this condition is found worldwide; reported prevalence rates average about 10 to 20% of the general population over age 60.
  • Cellular localization

    Secreted, extracellular space.
  • Database links

  • Alternative names

    • Lysyl oxidase like 1 antibody
    • LOL antibody
    • LOXL antibody
    • Lysyl oxidase homolog 1 antibody
    • Lysyl oxidase like protein 1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for LOXL1 using ab238152 at 1/100 dilution in immunohistochemical analysis.

References

ab238152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up