Overview

  • Product name

  • Description

    Rabbit polyclonal to LOXL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment within Human LOXL2 aa 454-742. The exact sequence is proprietary.
    Sequence:

    RNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNK VVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLN AEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQI HNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHK ASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDV PPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIW


    Database link: Q9Y4K0

  • Positive control

    • Human prostate tissue, PC-12, 293T, A431, H1299, NIH-3T3, JC and BCL-1 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab197779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.

Suggested antigen retrieval using heat mediated 10 mM Citrate buffer (pH 6.0) or Tris-EDTA buffer (pH 8.0).

WB 1/500 - 1/3000. Predicted molecular weight: 87 kDa.

Target

  • Tissue specificity

    Expressed in many tissues. Highest expression in reproductive tissues, placenta, uterus and prostate.
  • Sequence similarities

    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • LOR 2 antibody
    • LOR2 antibody
    • LOX L2 antibody
    • LOXL 2 antibody
    • LOXL2 antibody
    • LOXL2_HUMAN antibody
    • Lysyl oxidase homolog 2 antibody
    • Lysyl oxidase like 2 antibody
    • Lysyl oxidase like protein 2 antibody
    • Lysyl oxidase related 2 antibody
    • Lysyl oxidase related protein 2 antibody
    • Lysyl oxidase related protein WS9 14 antibody
    • Lysyl oxidase-like protein 2 antibody
    • Lysyl oxidase-related protein 2 antibody
    • Lysyl oxidase-related protein WS9-14 antibody
    • WS9 14 antibody
    see all

Images

  • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human prostate tissue labeling LOXL2 using ab197779 at 5 µg/ml.

  • All lanes : Anti-LOXL2 antibody (ab197779) at 1/1000 dilution

    Lane 1 : 293T whole cell lysate
    Lane 2 : A431 whole cell lysate
    Lane 3 : H1299 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 87 kDa



    7.5% SDS PAGE

  • All lanes : Anti-LOXL2 antibody (ab197779) at 1/1000 dilution

    Lane 1 : NIH-3T3 whole cell lysate
    Lane 2 : JC whole cell lysate
    Lane 3 : BCL-1 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 87 kDa



    7.5% SDS PAGE

  • All lanes : Anti-LOXL2 antibody (ab197779) at 1/1000 dilution

    Lane 1 : PC-12 whole cell lysate
    Lane 2 : Rat2 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 87 kDa



    7.5 % SDS-PAGE

References

ab197779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up