Overview

  • Product name

  • Description

    Rabbit polyclonal to LOXL3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse LOXL3 aa 509-712. N-terminal tags. Expressed in E. coli.
    Sequence:

    HITCKKTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAE ENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECH GHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANF GEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFT NNAM


    Database link: Q9Z175

  • Positive control

    • IHC-P: Mouse pancreas, spleen, cerebrum and lung tissue. WB: Recombinant mouse LOXL3 protein. Mouse serum.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Tissue specificity

    Expressed in many tissues, the highest levels among the tissues studied being seen in the placenta, heart, ovary, testis, small intestine and spleen.
  • Sequence similarities

    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • LOXL antibody
    • Loxl3 antibody
    • LOXL3_HUMAN antibody
    • Lysyl oxidase homolog 3 antibody
    • Lysyl oxidase like 3 antibody
    • Lysyl oxidase-like protein 3 antibody
    see all

Images

  • Anti-LOXL3 antibody (ab232884) at 3 µg/ml + Mouse serum

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for LOXL3 with ab232884 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for LOXL3 with ab232884 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse cerebrum tissue stained for LOXL3 with ab232884 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for LOXL3 with ab232884 at 20 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-LOXL3 antibody (ab232884) at 2 µg/ml + Recombinant mouse LOXL3 protein

References

ab232884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up