Overview

  • Product name

  • Description

    Rabbit polyclonal to LOXL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse LOXL4 aa 26-757.
    Sequence:

    QSSGTKKLRLVGPTDRPEEGRLEVLHQGQWGTVCDDDFALQEATVACRQL GFESALTWAHSAKYGQGEGPIWLDNVRCLGTEKTLDQCGSNGWGVSDCRH SEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRLKPILASAKRHSPV TEGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVW NLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRP ACPGGMHAVVSCVAGPHFRRQKPKPTRKESHAEELKVRLRSGAQVGEGRV EVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGAQLGQGLGPIH LSEVRCRGYERTLGDCLALEGSQNGCQHANDAAVRCNIPDMGFQNKVRLA GGRNSEEGVVEVQVEVNGVPRWGTVCSDHWGLTEAMVTCRQLGLGFANFA LKDTWYWQGTPEAKEVVMSGVRCSGTEMALQQCQRHGPVHCSHGPGRFSA GVACMNSAPDLVMNAQLVQETAYLEDRPLSMLYCAHEENCLSKSADHMDW PYGYRRLLRFSSQIYNLGRADFRPKAGRHSWIWHQCHRHYHSIEVFTHYD LLTLNGSKVAEGHKASFCLEDTNCPSGVQRRYACANFGEQGVAVGCWDTY RHDIDCQWVDITDVGPGDYIFQVVVNPTNDVAESDFSNNMIRCRCKYDGQ RVWLHNCHTGDSYRANAELSLEQEQRLRNNLI


    Database link: Q924C6

  • Positive control

    • WB: Rat brain tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab229716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 85 kDa (predicted molecular weight: 85 kDa).

Target

  • Function

    May modulate the formation of a collagenous extracellular matrix.
  • Tissue specificity

    Expressed in many tissues, the highest levels among the tissues studied being in the skeletal muscle, testis and pancreas. Expressed in cartilage.
  • Sequence similarities

    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4833426I20Rik antibody
    • FLJ21889 antibody
    • LOX L4 antibody
    • LOXC antibody
    • LOXL 4 antibody
    • LOXL4 antibody
    • LOXL4_HUMAN antibody
    • Lysyl oxidase homolog 4 antibody
    • Lysyl oxidase like 4 antibody
    • Lysyl oxidase like protein 4 antibody
    • Lysyl oxidase related C antibody
    • Lysyl oxidase related protein C antibody
    • Lysyl oxidase-like protein 4 antibody
    • Lysyl oxidase-related protein C antibody
    see all

Images

  • Anti-LOXL4 antibody (ab229716) at 1/500 dilution + Rat brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 85 kDa
    Observed band size: 85 kDa

References

ab229716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up