Overview

  • Product name

  • Description

    Rabbit polyclonal to LOXL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human LOXL4 aa 399-552. Expressed in E. coli. N-terminal tag.
    Sequence:

    GCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGS VCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCS GTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYL EDRP


    Database link: Q96JB6

  • Positive control

    • WB: Recombinant human LOXL4 protein. Pig pancreas tissue lysate. IHC-P: Human breast cancer, kidney, colorectal cancer, glioma and liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    May modulate the formation of a collagenous extracellular matrix.
  • Tissue specificity

    Expressed in many tissues, the highest levels among the tissues studied being in the skeletal muscle, testis and pancreas. Expressed in cartilage.
  • Sequence similarities

    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications

    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4833426I20Rik antibody
    • FLJ21889 antibody
    • LOX L4 antibody
    • LOXC antibody
    • LOXL 4 antibody
    • LOXL4 antibody
    • LOXL4_HUMAN antibody
    • Lysyl oxidase homolog 4 antibody
    • Lysyl oxidase like 4 antibody
    • Lysyl oxidase like protein 4 antibody
    • Lysyl oxidase related C antibody
    • Lysyl oxidase related protein C antibody
    • Lysyl oxidase-like protein 4 antibody
    • Lysyl oxidase-related protein C antibody
    see all

Images

  • Anti-LOXL4 antibody (ab232866) at 2 µg/ml + Pig pancreas tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for LOXL4 with ab232866 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for LOXL4 with ab232866 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for LOXL4 with ab232866 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for LOXL4 with ab232866 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for LOXL4 with ab232866 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-LOXL4 antibody (ab232866) at 2 µg/ml + Recombinant human LOXL4 protein

References

ab232866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up