Overview

  • Product name

  • Description

    Rabbit polyclonal to LPA-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human LPA-2 aa 261-351.
    Sequence:

    LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLL CCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL


    Database link: Q9HBW0

  • Positive control

    • IHC-P: Human prostate tissue.
  • General notes

    Protein previously labeled as EDG4.

Properties

Applications

Our Abpromise guarantee covers the use of ab224419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Plays a key role in phospholipase C-beta (PLC-beta) signaling pathway. Stimulates phospholipase C (PLC) activity in a manner that is independent of RALA activation.
  • Tissue specificity

    Expressed most abundantly in testes and peripheral blood leukocytes with less expression in pancreas, spleen, thymus and prostate. Little or no expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney, ovary, small intestine, or colon.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell surface. Cell membrane. Prior to LPA treatment found predominantly at the cell surface but in the presence of LPA colocalizes with RALA in the endocytic vesicles.
  • Information by UniProt
  • Database links

    • Alternative names

      • EDG 4 antibody
      • EDG-4 antibody
      • EDG4 antibody
      • Endothelial Cell Differentiation Gene 4 antibody
      • Endothelial differentiation lysophosphatidic acid G protein coupled receptor 4 antibody
      • FLJ93869 antibody
      • G protein coupled receptor antibody
      • IPA2 antibody
      • LPA 2 antibody
      • LPA receptor 2 antibody
      • LPA receptor EDG4 antibody
      • LPA-2 antibody
      • LPA2 antibody
      • LPAR2 antibody
      • LPAR2_HUMAN antibody
      • Lysophosphatidic acid receptor 2 antibody
      • Lysophosphatidic acid receptor Edg 4 antibody
      • Lysophosphatidic acid receptor Edg-4 antibody
      • Lysophosphatidic acid receptor EDG4 antibody
      see all

    Images

    • Paraffin-embedded human prostate tissue stained for LPA-2 with ab224419 at 1/20 dilution in immunohistochemical analysis.

    References

    ab224419 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab224419.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up