Overview

  • Product name

  • Description

    Rabbit polyclonal to LPA-4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human LPA-4 aa 1-43.
    Sequence:

    MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYN LNG


    Database link: Q99677

  • Positive control

    • WB: Mouse kidney tissue lysate. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as P2Y9. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 42 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1-alkyl- > 1-alkenyl-LPA.
  • Tissue specificity

    High expression in ovary. Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus and hippocampus.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5730485F04Rik antibody
    • G protein coupled receptor 23 antibody
    • G-protein coupled receptor 23 antibody
    • GPR23 antibody
    • LPA receptor 4 antibody
    • LPA-4 antibody
    • LPA4 antibody
    • Lpar4 antibody
    • LPAR4_HUMAN antibody
    • Lysophosphatidic acid receptor 4 antibody
    • Lysophosphatidic Acid Receptor P2Y9 antibody
    • P2RY9 antibody
    • P2Y purinoceptor 9 antibody
    • P2Y5 like antibody
    • P2Y5-like receptor antibody
    • P2Y9 antibody
    • Purinergic receptor 9 antibody
    • Purinergic receptor, P2Y, G-protein coupled, 9 antibody
    see all

Images

  • Anti-LPA-4 antibody (ab236731) at 1/1000 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 42 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling LPA-4 (green) using ab236731 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236731 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up