Overview

  • Product name

    Anti-LPAL2 antibody
  • Description

    Rabbit polyclonal to LPAL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LPAL2 aa 52-124.
    Sequence:

    WSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCN LTRCSDDEGTVFVPLTVIPVPSL


    Database link: Q16609

  • Positive control

    • IHC-P: Human testis and liver tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Database links

  • Alternative names

    • Apo(a) like protein 2 antibody
    • apo(a)rg C antibody
    • APOA2 antibody
    • APOAL antibody
    • APOARGC antibody
    • Apolipoprotein a related gene C protein antibody
    • Lipoprotein(a) like 2 pseudogene antibody
    • Lp(a) liker protein 2 antibody
    • Putative apolipoprotein(a) like protein 2 antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells stained for LPAL2 (green) using ab222848 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human liver tissue stained for LPAL2 with ab222848 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for LPAL2 with ab222848 at 1/100 dilution in immunohistochemical analysis.

References

ab222848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up