Overview

  • Product name

  • Description

    Rabbit polyclonal to LPAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LPAP aa 33-413. (Expressed in E.coli).
    Sequence:

    RNLLELKMVQVVFRHGARSPLKPLPLEDQVEWNPKLLEIPPQTRFEYTVA NLAGGPKPHSHYDTEYHRTVLRGGMFAGQLTKVGMQQMFALGERLRKNYV EDIPFLSPIYNPQEVFVRSTNMFRNLESTRCLLAGLFQRQKESVIIHTDE AISEVLYPNYQSCWSLREKTRGRKKAAISQPGILEDLEKVKAGVGIADSD NVDFFILLDNMVAEEAHSLLSSPALKRFAQLIEQRAVDMALYMLQQEDRE SIQMAVGPFLYILEGNLLKAVDPSTPPSKTRKMYLYATHDVTLLPMLLAL GIFDNKWPPFAVDLTVELYQHQESKEWFVRLSYNGQEQVPRGCPDKLCPL DKFLNTMSAYSVSPEKYRRLCSQTRIMELGE


    Database link: Q4FZU0

  • Positive control

    • IHC-P: Rat liver, lymph node and kidney tissues. WB: Recombinant mouse LPAP protein; Mouse kidney lysate.
  • General notes

     This product was previously labelled as ACP6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Hydrolyzes lysophosphatidic acid to monoacylglycerol.
  • Tissue specificity

    Highly expressed in kidney, heart, small intestine, muscle, liver, prostate, testis, ovary and weakly expressed in thymus and colon.
  • Sequence similarities

    Belongs to the histidine acid phosphatase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acid phosphatase 6 antibody
    • Acid phosphatase 6, lysophosphatidic antibody
    • Acid phosphatase like 1 antibody
    • Acid phosphatase like protein 1 antibody
    • Acid phosphatase-like protein 1 antibody
    • ACP6 antibody
    • ACPL1 antibody
    • LPAP antibody
    • Lysophosphatidic acid phosphatase 6 antibody
    • Lysophosphatidic acid phosphatase type 6 antibody
    • Lysophosphatidic acid phosphatase type 6 precursor antibody
    • lysophosphatidic antibody
    • PACPL1 antibody
    • PPA6_HUMAN antibody
    see all

Images

  • Paraffin-embedded rat kidney tissue stained for LPAP using ab232783 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat lymph node tissue stained for LPAP using ab232783 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat liver tissue stained for LPAP using ab232783 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LPAP antibody (ab232783) at 1 µg/ml + Mouse kidney lysate

    Predicted band size: 47 kDa

  • Anti-LPAP antibody (ab232783) at 2 µg/ml + Recombinant mouse LPAP protein.

    Predicted band size: 47 kDa

References

ab232783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up