Anti-LPCAT-2 antibody (ab224244)
Key features and details
- Rabbit polyclonal to LPCAT-2
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-LPCAT-2 antibody -
Description
Rabbit polyclonal to LPCAT-2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human LPCAT-2 aa 400-532.
Sequence:FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYIT EEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKI FTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE
Database link: Q7L5N7 -
Positive control
- WB: Human thyroid gland tissue lysate; NBT-II cell lysate. ICC/IF: A431 cells. IHC-P: Human thyroid gland tissue.
-
General notes
Previously labelled as Acyltransferase like 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224244 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 60 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. Involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF). Also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases. -
Pathway
Lipid metabolism; phospholipid metabolism. -
Sequence similarities
Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Contains 2 EF-hand domains. -
Domain
The HXXXXD motif is essential for acyltransferase activity. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 54947 Human
- Entrez Gene: 307713 Rat
- Omim: 612040 Human
- SwissProt: Q7L5N7 Human
- SwissProt: P0C1Q3 Rat
- Unigene: 460857 Human
-
Alternative names
- 1 acylglycerophosphocholine O acyltransferase antibody
- 1 alkylglycerophosphocholine O acetyltransferase antibody
- 1-acylglycerophosphocholine O-acyltransferase antibody
see all
Images
-
Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution + Human thyroid gland tissue lysate
Predicted band size: 60 kDa -
A431 (human epidermoid carcinoma cell line) cells stained for LPCAT-2 (green) using ab224244 (4 µg/ml) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT-2 antibody (ab224244)
Paraffin embedded human thyroid gland tissue stained for LPCAT-2 with ab224244 (1/50 dilution) in immunohistochemical analysis.
-
All lanes : Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
Lane 2 : NBT-II (rat cell line) cell lysate
Predicted band size: 60 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224244 has not yet been referenced specifically in any publications.