For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    lpcat-2-antibody-ab224244.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Lipid metabolism
Share by email

Anti-LPCAT-2 antibody (ab224244)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-LPCAT-2 antibody (ab224244)
  • Immunocytochemistry/ Immunofluorescence - Anti-LPCAT-2 antibody (ab224244)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT-2 antibody (ab224244)
  • Western blot - Anti-LPCAT-2 antibody (ab224244)

Key features and details

  • Rabbit polyclonal to LPCAT-2
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Rat, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-LPCAT-2 antibody
  • Description

    Rabbit polyclonal to LPCAT-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LPCAT-2 aa 400-532.
    Sequence:

    FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYIT EEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKI FTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE


    Database link: Q7L5N7
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Human thyroid gland tissue lysate; NBT-II cell lysate. ICC/IF: A431 cells. IHC-P: Human thyroid gland tissue.
  • General notes

    Previously labelled as Acyltransferase like 1. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Lipid metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab224244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 60 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. Involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF). Also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases.
  • Pathway

    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities

    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
    Contains 2 EF-hand domains.
  • Domain

    The HXXXXD motif is essential for acyltransferase activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Target information above from: UniProt accession Q7L5N7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 54947 Human
    • Entrez Gene: 307713 Rat
    • Omim: 612040 Human
    • SwissProt: Q7L5N7 Human
    • SwissProt: P0C1Q3 Rat
    • Unigene: 460857 Human
    • Alternative names

      • 1 acylglycerophosphocholine O acyltransferase antibody
      • 1 alkylglycerophosphocholine O acetyltransferase antibody
      • 1-acylglycerophosphocholine O-acyltransferase antibody
      • 1-alkylglycerophosphocholine O-acetyltransferase antibody
      • A330042H22 antibody
      • Acetyl CoA:lyso PAF acetyltransferase antibody
      • Acetyl-CoA:lyso-PAF acetyltransferase antibody
      • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase antibody
      • acyl CoA:lysophosphatidylcholine acyltransferase 2 antibody
      • Acyl-CoA:lysophosphatidylcholine acyltransferase member 1 antibody
      • Acyltransferase like 1 antibody
      • Acyltransferase like 1A antibody
      • Acyltransferase-like 1 antibody
      • AYTL1 antibody
      • Aytl1a antibody
      • DKFZp686H22112 antibody
      • FLJ20481 antibody
      • lpafat1 antibody
      • LPC acyltransferase 2 antibody
      • LPCAT-2 antibody
      • LPCAT2 antibody
      • Lyso PAF acetyltransferase antibody
      • Lyso platelet activating factor (PAF) acetyltransferase antibody
      • Lyso-PAF acetyltransferase antibody
      • LysoPAFAT antibody
      • LysoPAFAT/LPCAT2 antibody
      • LysoPC acyltransferase 2 antibody
      • Lysophosphatidylcholine acyltransferase 2 antibody
      • OTTMUSP00000029641 antibody
      • PCAT2_HUMAN antibody
      • RGD1563994 antibody
      see all

    Images

    • Western blot - Anti-LPCAT-2 antibody (ab224244)
      Western blot - Anti-LPCAT-2 antibody (ab224244)
      Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution + Human thyroid gland tissue lysate

      Predicted band size: 60 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-LPCAT-2 antibody (ab224244)
      Immunocytochemistry/ Immunofluorescence - Anti-LPCAT-2 antibody (ab224244)

      A431 (human epidermoid carcinoma cell line) cells stained for LPCAT-2 (green) using ab224244 (4 µg/ml) in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT-2 antibody (ab224244)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT-2 antibody (ab224244)

      Paraffin embedded human thyroid gland tissue stained for LPCAT-2 with ab224244 (1/50 dilution) in immunohistochemical analysis.

    • Western blot - Anti-LPCAT-2 antibody (ab224244)
      Western blot - Anti-LPCAT-2 antibody (ab224244)
      All lanes : Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution

      Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
      Lane 2 : NBT-II (rat cell line) cell lysate

      Predicted band size: 60 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab224244? Please let us know so that we can cite the reference in this datasheet.

    ab224244 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab224244.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.