Anti-LPCAT-2 antibody (ab224244)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-LPCAT-2 antibody -
Description
Rabbit polyclonal to LPCAT-2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human LPCAT-2 aa 400-532.
Sequence:FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYIT EEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKI FTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE
Database link: Q7L5N7 -
Positive control
- WB: Human thyroid gland tissue lysate; NBT-II cell lysate. ICC/IF: A431 cells. IHC-P: Human thyroid gland tissue.
-
General notes
Previously labelled as Acyltransferase like 1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224244 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | 1/100 - 1/250. Predicted molecular weight: 60 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. Involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF). Also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases. -
Pathway
Lipid metabolism; phospholipid metabolism. -
Sequence similarities
Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Contains 2 EF-hand domains. -
Domain
The HXXXXD motif is essential for acyltransferase activity. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 54947 Human
- Entrez Gene: 307713 Rat
- Omim: 612040 Human
- SwissProt: Q7L5N7 Human
- SwissProt: P0C1Q3 Rat
- Unigene: 460857 Human
-
Alternative names
- 1 acylglycerophosphocholine O acyltransferase antibody
- 1 alkylglycerophosphocholine O acetyltransferase antibody
- 1-acylglycerophosphocholine O-acyltransferase antibody
see all
Images
-
Western blot - Anti-LPCAT-2 antibody (ab224244)Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution + Human thyroid gland tissue lysate
Predicted band size: 60 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-LPCAT-2 antibody (ab224244)A431 (human epidermoid carcinoma cell line) cells stained for LPCAT-2 (green) using ab224244 (4 µg/ml) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT-2 antibody (ab224244)Paraffin embedded human thyroid gland tissue stained for LPCAT-2 with ab224244 (1/50 dilution) in immunohistochemical analysis.
-
Western blot - Anti-LPCAT-2 antibody (ab224244)All lanes : Anti-LPCAT-2 antibody (ab224244) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
Lane 2 : NBT-II (rat cell line) cell lysate
Predicted band size: 60 kDa
Datasheets and documents
References
ab224244 has not yet been referenced specifically in any publications.
