Anti-LPCAT3 antibody (ab223070)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-LPCAT3 antibody
See all LPCAT3 primary antibodies -
Description
Rabbit polyclonal to LPCAT3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat
-
Immunogen
Recombinant fragment corresponding to Human LPCAT3 aa 306-363.
Sequence:EEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIFKRLKF LGNKELSQ
Database link: Q6P1A2 -
Positive control
- IHC-P: Human liver and pancreatic tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab223070 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. -
Tissue specificity
Highly expressed in liver, pancreas and adipose tissue. Very low expression in skeletal muscle and heart. Detected in neutrophils. -
Pathway
Lipid metabolism; phospholipid metabolism. -
Sequence similarities
Belongs to the membrane-bound acyltransferase family. -
Domain
The di-lysine motif confers endoplasmic reticulum localization. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10162 Human
- SwissProt: Q6P1A2 Human
- Unigene: 655248 Human
-
Alternative names
- 1-acylglycerophosphocholine O-acyltransferase antibody
- 1-acylglycerophosphoserine O-acyltransferase antibody
- LPCAT antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT3 antibody (ab223070)Paraffin-embedded human liver tissue stained for LPCAT3 using ab223070 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT3 antibody (ab223070)Paraffin-embedded human pancreatic tissue stained for LPCAT3 using ab223070 at 1/100 dilution in immunohistochemical analysis.
Protocols
References
ab223070 has not yet been referenced specifically in any publications.
