Anti-LPCAT3 antibody (ab223070)
Key features and details
- Rabbit polyclonal to LPCAT3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LPCAT3 antibody
See all LPCAT3 primary antibodies -
Description
Rabbit polyclonal to LPCAT3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human LPCAT3 aa 306-363.
Sequence:EEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIFKRLKF LGNKELSQ
Database link: Q6P1A2 -
Positive control
- IHC-P: Human liver and pancreatic tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223070 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. -
Tissue specificity
Highly expressed in liver, pancreas and adipose tissue. Very low expression in skeletal muscle and heart. Detected in neutrophils. -
Pathway
Lipid metabolism; phospholipid metabolism. -
Sequence similarities
Belongs to the membrane-bound acyltransferase family. -
Domain
The di-lysine motif confers endoplasmic reticulum localization. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10162 Human
- SwissProt: Q6P1A2 Human
- Unigene: 655248 Human
-
Alternative names
- 1-acylglycerophosphocholine O-acyltransferase antibody
- 1-acylglycerophosphoserine O-acyltransferase antibody
- LPCAT antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT3 antibody (ab223070)
Paraffin-embedded human liver tissue stained for LPCAT3 using ab223070 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LPCAT3 antibody (ab223070)
Paraffin-embedded human pancreatic tissue stained for LPCAT3 using ab223070 at 1/100 dilution in immunohistochemical analysis.
References (0)
ab223070 has not yet been referenced specifically in any publications.