Overview

  • Product name

  • Description

    Rabbit polyclonal to LPCAT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human LPCAT3 aa 122-233. Expressed in E.coli. N-terminal tag.
    Sequence:

    MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSS EQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPG KIPNSIIPALKR


    Database link: Q6P1A2

  • Positive control

    • WB: Recombinant human LPCAT3 protein, rat liver and mouse liver tissue lysates. IHC-P: Human kidney, rectum, thyroid cancer and breast cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
  • Tissue specificity

    Highly expressed in liver, pancreas and adipose tissue. Very low expression in skeletal muscle and heart. Detected in neutrophils.
  • Pathway

    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities

    Belongs to the membrane-bound acyltransferase family.
  • Domain

    The di-lysine motif confers endoplasmic reticulum localization.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1-acylglycerophosphocholine O-acyltransferase antibody
    • 1-acylglycerophosphoserine O-acyltransferase antibody
    • LPCAT antibody
    • Lpcat3 antibody
    • LPLAT 5 antibody
    • LPSAT antibody
    • Lyso-PC acyltransferase 3 antibody
    • Lyso-PC acyltransferase antibody
    • Lyso-PS acyltransferase antibody
    • Lysophosphatidylcholine acyltransferase 3 antibody
    • Lysophosphatidylcholine acyltransferase antibody
    • Lysophosphatidylserine acyltransferase antibody
    • Lysophospholipid acyltransferase 5 antibody
    • MBOA5 antibody
    • MBOA5_HUMAN antibody
    • Membrane-bound O-acyltransferase domain-containing protein 5 antibody
    • O-acyltransferase domain-containing protein 5 antibody
    see all

Images

  • All lanes : Anti-LPCAT3 antibody (ab232958) at 2 µg/ml

    Lane 1 : Rat liver lysate
    Lane 2 : Mouse liver lysate

    Predicted band size: 56 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for LPCAT3 using ab232958 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for LPCAT3 using ab232958 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human thyroid cancer tissue stained for LPCAT3 using ab232958 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for LPCAT3 using ab232958 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-LPCAT3 antibody (ab232958) at 2 µg/ml + Recombinant human LPCAT3 protein

    Predicted band size: 56 kDa

References

ab232958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up