Anti-LPD antibody (ab238758)
Key features and details
- Rabbit polyclonal to LPD
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LPD antibody -
Description
Rabbit polyclonal to LPD -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human LPD aa 351-600.
Sequence:AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKM LLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFY GAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLV PGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGD AGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
Database link: Q96GR2 -
Positive control
- IHC-P: Human prostate cancer and kidney tissues.
-
General notes
This product was previously labelled as ACSBG1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab238758 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids. -
Tissue specificity
Expressed primarily in brain. Expressed at lower level in testis and adrenal gland. Present in all regions of brain except pituitary. -
Sequence similarities
Belongs to the ATP-dependent AMP-binding enzyme family. Bubblegum subfamily. -
Cellular localization
Cytoplasm. Cytoplasmic vesicle. Microsome. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 515577 Cow
- Entrez Gene: 101864984 Cynomolgus monkey
- Entrez Gene: 23205 Human
- Entrez Gene: 94180 Mouse
- Entrez Gene: 171410 Rat
- Omim: 614362 Human
- SwissProt: Q2KHW5 Cow
- SwissProt: Q4R4P9 Cynomolgus monkey
see all -
Alternative names
- ACBG1_HUMAN antibody
- ACSBG 1 antibody
- ACSBG1 antibody
see all
Images
-
Paraffin-embedded human prostate cancer tissue stained for LPD using ab238758 at 1/100 dilution in immunohistochemical analysis.
-
Paraffin-embedded human kidney tissue stained for LPD using ab238758 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238758 has not yet been referenced specifically in any publications.