Overview

  • Product name

  • Description

    Rabbit polyclonal to LPGAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human LPGAT1 aa 49-198.
    Sequence:

    LDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVML VNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFF IRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAF


    Database link: Q92604

  • Positive control

    • IHC-P: Human liver tissue. WB: A549 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 43 kDa.

Target

  • Function

    Lysophoshatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor.
  • Tissue specificity

    Highly expressed in liver and placenta. Also expressed in peripheral blood, lung, kidney and brain. Detected at lower levels in colon.
  • Sequence similarities

    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
  • Domain

    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acyl CoA:lysophosphatidylglycerol acyltransferase 1 antibody
    • Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 antibody
    • FAM34A antibody
    • FAM34A1 antibody
    • Family with sequence similarity 34 member A antibody
    • KIAA0205 antibody
    • LGAT1_HUMAN antibody
    • Lpgat1 antibody
    • lysophosphatidylglycerol acyltransferase 1 antibody
    • NET8 antibody
    see all

Images

  • Anti-LPGAT1 antibody (ab230647) at 1/500 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 43 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for LPGAT1 using ab230647 at 10 µg/ml in immunohistochemical analysis.

References

ab230647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up