Overview

  • Product name
  • Description
    Rabbit polyclonal to LPO
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat LPO aa 351-589. (Expressed in E.coli).
    Sequence:

    PCEVINATAGVPCFLAGDSRASEQILLATSHTLFIREHNRLARELSTLNP HWDGETLYQETRKIMGAFIQIITFRDYLPILLGDEMQKWIPPYQGYNESV DPRISNVFTFAFRFGHLEIPSTVSRLDENYQPWGSEPELPLHTVFFNTWR LVKDGGIDPLVRGLLAKKAKLMHQDRMMTGELRNKLFQPTHTIHGFDLAS INIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENE


    Database link: P22079

  • Positive control
    • WB: Human saliva; Recombinant rat LPO protein. IHC-P: Rat testis, stomach, intestine, kidney and pancreas tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 78 kDa.

Target

  • Relevance
    Lactoperoxidase is a natural antibacterial agent in bovine milk, a medium otherwise rich in its ability to support bacterial growth. Milk lactoperoxidase levels vary among species, ranging from little or none in humans to very high concentrations in guinea pigs. Interestingly, lactoperoxidase from milk is identical to the lacrimal and salivary forms of the enzyme. In addition, the enzyme catalyzes the hydrogen peroxide oxidation of iodine and can be employed in labelling proteins with radioiodine.
  • Cellular localization
    Secreted - extracellular space
  • Database links
  • Alternative names
    • Lactoperoxidase antibody
    • LPO antibody
    • Salivary peroxidase antibody
    • SAPX antibody
    • SPO antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for LPO with ab231026 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for LPO with ab231026 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat intestine tissue stained for LPO with ab231026 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for LPO with ab231026 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for LPO with ab231026 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LPO antibody (ab231026) at 2 µg/ml + Human saliva

    Predicted band size: 78 kDa

  • Anti-LPO antibody (ab231026) at 2 µg/ml + Recombinant rat LPO protein

    Predicted band size: 78 kDa

References

ab231026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up