Overview

  • Product name

  • Description

    Rabbit polyclonal to LPP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LPP aa 227-391.
    Sequence:

    SAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYI PPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTW KREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPVSAPCAPPLQPKGGHSG QLGPSSVAPSFRPED


    Database link: Q93052

  • Positive control

    • WB: HEK-293T whole cell lysate. IHC-P: Human small intestine and pancreatic cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/300.
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.

Target

  • Function

    May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. Also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.
  • Tissue specificity

    Expressed in a wide variety of tissues but no or very low expression in brain and peripheral leukocytes.
  • Involvement in disease

    Note=A chromosomal aberration involving LPP is associated with a subclass of benign mesenchymal tumors known as lipomas. Translocation t(3;12)(q27-q28;q13-q15) with HMGA2 is shown in lipomas.
    Note=A chromosomal aberration involving LPP is associated with pulmonary chondroid hamartomas. Translocation t(3;12)(q27-q28;q14-q15) with HMGA2 is detected in pulmonary chondroid hamartomas.
    Note=A chromosomal aberration involving LPP is associated with parosteal lipomas. Translocation t(3;12)(q28;q14) with HMGA2 is also shown in one parosteal lipoma.
    Note=A chromosomal aberration involving LPP is associated with acute monoblastic leukemia. Translocation t(3;11)(q28;q23) with MLL is associated with acute monoblastic leukemia.
  • Sequence similarities

    Belongs to the zyxin/ajuba family.
    Contains 3 LIM zinc-binding domains.
  • Cellular localization

    Nucleus. Cytoplasm. Cell junction. Cell membrane. Found in the nucleus, in the cytoplasm and at cell adhesion sites. Shuttles between the cytoplasm and the nucleus. It has been found in sites of cell adhesion such as cell-to-cell contact and focal adhesion which are membrane attachment sites of cells to the extracellular matrix. Mainly nuclear when fused with HMGA2/HMGIC and MLL.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp779O0231 antibody
    • FLJ30652 antibody
    • FLJ41512 antibody
    • LIM domain containing preferred translocation partner in lipoma antibody
    • LIM domain-containing preferred translocation partner in lipoma antibody
    • LIM protein antibody
    • Lipoma preferred partner antibody
    • Lipoma-preferred partner antibody
    • lpp antibody
    • LPP_HUMAN antibody
    see all

Images

  • Paraffin-embedded small intestine tissue stained for LPP using ab234999 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydraton, antigel retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibosy and visualized using an HRP conjugated SP system.

  • Anti-LPP antibody (ab234999) at 1/500 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 66 kDa

  • Paraffin-embedded pancreatic cancer tissue stained for LPP using ab234999 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydraton, antigel retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibosy and visualized using an HRP conjugated SP system.

References

ab234999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up