Overview

  • Product name

    Anti-LR8 antibody
  • Description

    Rabbit polyclonal to LR8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human LR8 aa 1-64.
    Sequence:

    MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHP GDTVPSTARIGYEQ


    Database link: Q3YBM2

  • Positive control

    • WB: Human placenta lysate. IHC-P: Human breast cancer and skin tissues. ICC/IF: L02 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.

Target

  • Relevance

    LR8 may be involved in the control of dendritic cell maturation and thus may play a role in the induction or maintenance of allograft tolerance. It's function is unknown.
  • Cellular localization

    Nuclear membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • LR 8 antibody
    • TMEM176B antibody
    • Transmembrane protein 176B antibody

Images

  • Anti-LR8 antibody (ab236860) at 1/500 dilution + Human placenta lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 29 kDa

  • Paraffin-embedded human breast cancer tissue stained for LR8 using ab236860 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for LR8 using ab236860 at 1/100 dilution in immunohistochemical analysis.

  • L02 (human immortal liver cell line) cells stained for LR8 (green) using ab236860 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up