Overview

  • Product name

    Anti-LRBA/BGL antibody - Membrane Vesicle Marker
    See all LRBA/BGL primary antibodies
  • Description

    Rabbit polyclonal to LRBA/BGL - Membrane Vesicle Marker
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LRBA/BGL aa 1-251 (N terminal).
    Sequence:

    MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAV LTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLE KCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIAD LLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQK YGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKD K


    Database link: P50851

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: MCF7 and U251 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.

Target

  • Function

    May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or membrane deposition of immune effector molecules.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 BEACH domain.
    Contains 6 WD repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum. Golgi apparatus > trans-Golgi network. Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beige-like protein antibody
    • BGL antibody
    • C80285 antibody
    • CDC4-like protein antibody
    • CDC4L antibody
    • CVID8 antibody
    • D3Ertd775e antibody
    • Lab300 antibody
    • LBA antibody
    • Lipopolysaccharide-responsive and beige-like anchor protein antibody
    • LPS-responsive vesicle trafficking beach and anchor containing antibody
    • Lrba antibody
    • LRBA_HUMAN antibody
    • Vesicle trafficking beach and anchor containing antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling LRBA/BGL with ab193027 at 1/20 dilution.

  • Immunocytochemistry/Immunofluorescence analysis of U251 cells labelling LRBA/BGL with ab193027 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells labelling LRBA/BGL with ab193027 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

ab193027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up